[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57307.1
DDBJ      :             Recombination protein O, RecO
Swiss-Prot:RECO_NITOC   RecName: Full=DNA repair protein recO;AltName: Full=Recombination protein O;

Homologs  Archaea  0/68 : Bacteria  257/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.40.4g.45.1
:246 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->78 1u5kA1  b.40.4.13 * 3e-15 22.7 %
:RPS:SCOP  82->222 1u5kA2  g.45.1.2 * 2e-05 14.0 %
:HMM:SCOP  1->79 1u5kA1 b.40.4.13 * 6.5e-18 36.8 %
:HMM:SCOP  87->222 1u5kA2 g.45.1.2 * 2.6e-05 28.4 %
:RPS:PFM   10->74 PF11967 * RecO_N 2e-13 52.3 %
:HMM:PFM   1->77 PF11967 * RecO_N 2.2e-27 41.6 77/80  
:HMM:PFM   84->227 PF02565 * RecO_C 7.7e-24 44.3 106/118  
:BLT:SWISS 1->246 RECO_NITOC e-121 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57307.1 GT:GENE ABA57307.1 GT:PRODUCT Recombination protein O, RecO GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 867342..868082 GB:FROM 867342 GB:TO 868082 GB:DIRECTION + GB:PRODUCT Recombination protein O, RecO GB:PROTEIN_ID ABA57307.1 GB:DB_XREF GI:76882626 InterPro:IPR003717 LENGTH 246 SQ:AASEQ MRVVLQPAYVLHSRPYRETSALVEVFTPEYGRVGLVAKGVKRQRTHRFSLLQPFCPLLLSWTGRGDLVTLTGAEAAGPIPVLTGEGLICAFYLNELLLRLLPRRDPLEALFSVYAHSLPSLIHAQQRQQILRLFERDLLAYLGYGLILKYEAGTSRPIEAGQWYSYQLEKGPVRLLSEDLEGMKVRGHTLQALARGALADPASLGEAKRLLRWLLAFHLGDKPLKSRGLLEELRRLGNVSRKEERP GT:EXON 1|1-246:0| SW:ID RECO_NITOC SW:DE RecName: Full=DNA repair protein recO;AltName: Full=Recombination protein O; SW:GN Name=recO; OrderedLocusNames=Noc_0794; SW:KW Complete proteome; DNA damage; DNA recombination; DNA repair. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->246|RECO_NITOC|e-121|100.0|246/246| GO:SWS:NREP 3 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006310|"GO:DNA recombination"|DNA recombination| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| SEG 93->110|lnelllrllprrdpleal| SEG 227->237|rglleelrrlg| RP:PFM:NREP 1 RP:PFM:REP 10->74|PF11967|2e-13|52.3|65/78|RecO_N| HM:PFM:NREP 2 HM:PFM:REP 1->77|PF11967|2.2e-27|41.6|77/80|RecO_N| HM:PFM:REP 84->227|PF02565|7.7e-24|44.3|106/118|RecO_C| RP:SCP:NREP 2 RP:SCP:REP 1->78|1u5kA1|3e-15|22.7|75/78|b.40.4.13| RP:SCP:REP 82->222|1u5kA2|2e-05|14.0|136/157|g.45.1.2| HM:SCP:REP 1->79|1u5kA1|6.5e-18|36.8|76/0|b.40.4.13|1/1|Nucleic acid-binding proteins| HM:SCP:REP 87->222|1u5kA2|2.6e-05|28.4|134/0|g.45.1.2|1/1|ArfGap/RecO-like zinc finger| OP:NHOMO 260 OP:NHOMOORG 258 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111211111111111111111111111111111--1111111111111211111111111--1111---------------------------------------------------------1111111111111-11111-111111111111---1111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1111111---111-11111111111111111----------1111111111111111111---------11111111111111111111111111111----------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 40-48, 237-246| PSIPRED cccccccEEEEEEccccccccEEEEEccccccEEEEEEcccccccccccccccccEEEEEEEEcccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccHHHHcccccccccccEEEEEcccEEEEEcccccccEEcHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccc //