[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57330.1
DDBJ      :             Outer membrane chaperone Skp (OmpH)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  226/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.48.1
:178 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->173 1sg2C PDBj 2e-14 34.3 %
:RPS:SCOP  34->173 1sg2A  f.48.1.1 * 1e-23 33.6 %
:HMM:SCOP  30->173 1u2mA_ f.48.1.1 * 5.5e-27 40.6 %
:RPS:PFM   18->172 PF03938 * OmpH 9e-13 30.3 %
:HMM:PFM   21->173 PF03938 * OmpH 2.7e-28 28.2 149/158  
:BLT:SWISS 34->173 SKP_ERWCT 1e-19 33.6 %
:TM
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57330.1 GT:GENE ABA57330.1 GT:PRODUCT Outer membrane chaperone Skp (OmpH) GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 891355..891891 GB:FROM 891355 GB:TO 891891 GB:DIRECTION + GB:PRODUCT Outer membrane chaperone Skp (OmpH) GB:PROTEIN_ID ABA57330.1 GB:DB_XREF GI:76882649 InterPro:IPR005632 LENGTH 178 SQ:AASEQ MVRMDKLFKLIVFVAFLLLGSMIVIAPAGAVDLKIGAVNAVKLLDEAPQKEAALEILKKEFEVRNRELVAKQKKLRGLEDRFNRDAAIMSEADRKALERDILNQNRDLKRDQEVFREDYNIRRNEEFRKLQEEIAKAIVDLAEKKKYDLVVYEGVIYASDKVDITADVLKLLKSQYRP GT:EXON 1|1-178:0| BL:SWS:NREP 1 BL:SWS:REP 34->173|SKP_ERWCT|1e-19|33.6|140/165| COIL:NAA 12 COIL:NSEG 1 COIL:REGION 65->76| TM:NTM 1 TM:REGION 15->37| BL:PDB:NREP 1 BL:PDB:REP 34->173|1sg2C|2e-14|34.3|137/142| RP:PFM:NREP 1 RP:PFM:REP 18->172|PF03938|9e-13|30.3|155/158|OmpH| HM:PFM:NREP 1 HM:PFM:REP 21->173|PF03938|2.7e-28|28.2|149/158|OmpH| GO:PFM:NREP 1 GO:PFM GO:0005515|"GO:protein binding"|PF03938|IPR005632| RP:SCP:NREP 1 RP:SCP:REP 34->173|1sg2A|1e-23|33.6|137/141|f.48.1.1| HM:SCP:REP 30->173|1u2mA_|5.5e-27|40.6|138/143|f.48.1.1|1/1|OmpH-like| OP:NHOMO 230 OP:NHOMOORG 228 OP:PATTERN -------------------------------------------------------------------- --1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111112111111112111111111111111-----1-------------1--11--1------------------------------111111--11--111111111111111111111-111-1------11111111111111111-1111111111111111111111111111111111111111111111111111111111111111111-11111111111---------1--------1------------1111----1-----------------1111-11111-1111------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 144 STR:RPRED 80.9 SQ:SECSTR ############################cTTc#cEEEEcHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccEEEEGGGcccTTccccHHHHHHHcc##### DISOP:02AL 1-2, 52-55, 57-60, 83-99, 111-125, 177-178| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccccHHccccccccHHHHHHHHccccc //