[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57366.1
DDBJ      :             cell division protein FtsB
Swiss-Prot:FTSB_NITOC   RecName: Full=Cell division protein ftsB homolog;

Homologs  Archaea  0/68 : Bacteria  227/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:RPS:PFM   20->87 PF04977 * DivIC 9e-06 38.8 %
:HMM:PFM   11->90 PF04977 * DivIC 7.8e-26 50.0 80/80  
:BLT:SWISS 1->91 FTSB_NITOC 1e-38 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57366.1 GT:GENE ABA57366.1 GT:PRODUCT cell division protein FtsB GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 935229..935504 GB:FROM 935229 GB:TO 935504 GB:DIRECTION + GB:PRODUCT cell division protein FtsB GB:PROTEIN_ID ABA57366.1 GB:DB_XREF GI:76882685 InterPro:IPR007060 LENGTH 91 SQ:AASEQ MKFIVGLLLVLLLALQYQLWISKDGLGELRQLSRSIKQQRHENATLIERNQVLKAEVQDLKSGLDALEERARSGLGMIKQGETFFQVVEEP GT:EXON 1|1-91:0| SW:ID FTSB_NITOC SW:DE RecName: Full=Cell division protein ftsB homolog; SW:GN Name=ftsB; OrderedLocusNames=Noc_0853; SW:KW Cell cycle; Cell division; Cell inner membrane; Cell membrane;Coiled coil; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->91|FTSB_NITOC|1e-38|100.0|91/91| GO:SWS:NREP 6 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 1 TM:REGION 3->25| SEG 7->19|lllvlllalqyql| RP:PFM:NREP 1 RP:PFM:REP 20->87|PF04977|9e-06|38.8|67/78|DivIC| HM:PFM:NREP 1 HM:PFM:REP 11->90|PF04977|7.8e-26|50.0|80/80|DivIC| GO:PFM:NREP 1 GO:PFM GO:0007049|"GO:cell cycle"|PF04977|IPR007060| OP:NHOMO 228 OP:NHOMOORG 228 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111--------------1---------1111-1----1-----1---1111111111111111111111-----------------------------------------------------------111-1-111111111111111111111111---11-1------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--111111111111111-111111111111111-------1111111111111111111111----------1111111111111111111111111111----------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHcccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccccEEEEEcccc //