Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57373.1
DDBJ      :             putative transposase gene of IS630 family insertion sequence ISY100h

Homologs  Archaea  0/68 : Bacteria  81/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
:174 amino acids
:BLT:PDB   104->168 3f2kA PDBj 5e-04 30.8 %
:HMM:PFM   85->144 PF03184 * DDE 2.6e-05 23.3 60/217  
:BLT:SWISS 113->174 TC3A_CAEEL 2e-04 34.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57373.1 GT:GENE ABA57373.1 GT:PRODUCT putative transposase gene of IS630 family insertion sequence ISY100h GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(942554..943078) GB:FROM 942554 GB:TO 943078 GB:DIRECTION - GB:PRODUCT putative transposase gene of IS630 family insertion sequence ISY100h GB:PROTEIN_ID ABA57373.1 GB:DB_XREF GI:76882692 LENGTH 174 SQ:AASEQ MTGYTQRCNMKRKSFLRLRERYRRRGKRFVYLDESGFEPEVSRRYAYAPKGRRVYGLISGHRRPRTSLLAARMDEGFEAPFLFEGTCNTAVFNAWLEKELCPLLNSNHIVIMDNAPFHKAVSSREIIKKTGAGILFLPPYSPDFNPIEKDFGNIKKIREYNEHETLENIVAAYQ GT:EXON 1|1-174:0| BL:SWS:NREP 1 BL:SWS:REP 113->174|TC3A_CAEEL|2e-04|34.4|61/100| SEG 12->29|rksflrlreryrrrgkrf| BL:PDB:NREP 1 BL:PDB:REP 104->168|3f2kA|5e-04|30.8|65/195| HM:PFM:NREP 1 HM:PFM:REP 85->144|PF03184|2.6e-05|23.3|60/217|DDE| OP:NHOMO 758 OP:NHOMOORG 92 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------3--------3-----1------I45B15UD----------R-3-3-9------------1---------------------------------------------------------------------------------------------------------74111-2-311--------------34---444--------------------------------------------------2---8--------4----4S-----2----------B-3111-F11----1---5-7--17D2----4--------1--------253--1------------2R------1---------3--1-1---------------------------------------------8---7---------16---1-17-1----------------------------------------------------------------------------------------------I----------------------------------------------------------------------------------------------Q--------------------------------------2-E-------------------kv-c-muk---------------------------------------------------------------------------------------- -------------------------31-------------------1---2--------------------------------------3-----------91--6----1-----------------------------------------------------------------------------------1--1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 40.8 SQ:SECSTR #################################################################################################HHHHHHcccccEEEccccHHHHcTTHHHHHHHHTcEEccccTTcGGGcHHHHHHHHHHTTcccccHHHHHH###### DISOP:02AL 174-175| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccEEEEccccEEEEEEcccccccEEEEEEEEcccEEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHcccEEEEccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHc //