[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57382.1
DDBJ      :             tetrapyrrole methylase family protein / MazG family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  488/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.204.1a.7.7
:180 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   52->176 3craB PDBj 9e-22 37.6 %
:RPS:PDB   49->176 3crcA PDBj 2e-25 42.9 %
:RPS:SCOP  76->147 1ugoA  a.7.7.1 * 3e-12 16.7 %
:HMM:SCOP  52->154 2gtaD1 a.204.1.2 * 1.7e-22 42.6 %
:RPS:PFM   85->142 PF03819 * MazG 4e-08 49.1 %
:HMM:PFM   82->142 PF03819 * MazG 1.2e-10 35.0 60/74  
:BLT:SWISS 4->176 MAZG_HAEIN 4e-32 38.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57382.1 GT:GENE ABA57382.1 GT:PRODUCT tetrapyrrole methylase family protein / MazG family protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(951056..951598) GB:FROM 951056 GB:TO 951598 GB:DIRECTION - GB:PRODUCT tetrapyrrole methylase family protein / MazG family protein GB:PROTEIN_ID ABA57382.1 GB:DB_XREF GI:76882701 LENGTH 180 SQ:AASEQ MTTAKNTTQRSPHGFGKQPSGADTTLDGKTSVAEEQRRQSHTGGKAKTFASLPQELPALARALELQKRAAQVGFDWASAAPILEKIEEELQEVRAALTSNENSSRLQEEIGDLLFACINLARHTGIMPEAALDSCSDKFERRFRYIEYMLTKRASSPAEASLAEMDTLWEEAKAKEGEFN GT:EXON 1|1-180:0| BL:SWS:NREP 1 BL:SWS:REP 4->176|MAZG_HAEIN|4e-32|38.4|172/263| BL:PDB:NREP 1 BL:PDB:REP 52->176|3craB|9e-22|37.6|125/222| RP:PDB:NREP 1 RP:PDB:REP 49->176|3crcA|2e-25|42.9|126/225| RP:PFM:NREP 1 RP:PFM:REP 85->142|PF03819|4e-08|49.1|57/67|MazG| HM:PFM:NREP 1 HM:PFM:REP 82->142|PF03819|1.2e-10|35.0|60/74|MazG| RP:SCP:NREP 1 RP:SCP:REP 76->147|1ugoA|3e-12|16.7|72/99|a.7.7.1| HM:SCP:REP 52->154|2gtaD1|1.7e-22|42.6|101/0|a.204.1.2|1/1|all-alpha NTP pyrophosphatases| OP:NHOMO 488 OP:NHOMOORG 488 OP:PATTERN -------------------------------------------------------------------- 1-1---------------------------------------------------------------------------11-1-111111111-1111--11111111111---------------11111111111-11--1111-1111111-11111111111-1111111-----11--------11-1111111111111111111111111111111111------11------------------------------------------------------------------------------------------11-11111111111111111111-11--1--11--1111111111111--11-1111-11-11111111111111111111111-1-11111111111-1111111111111111111111111111111111111111111------------1----1----11------11111-----------------------------------------------------------------------1111-111111111-1111111111111111----------------------------111111111111111111111111111111---1111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1-------1-1111111111111111111111111111111111111111111111111----------1111111111111111111111111111--11111111--------1---------------------------11111-111-1-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 151 STR:RPRED 83.9 SQ:SECSTR #########################cHHHHHHHHHHHHHHcccccccTcccccccccHHHHHHHHHHHHHTTTcccccHHHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHHHHHTTTTccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccTTHHHHHHHHHHHc#### DISOP:02AL 33-52, 175-180| PSIPRED ccHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccc //