[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57388.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:89 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   21->64 PF03235 * DUF262 2e-10 52.3 %
:HMM:PFM   15->63 PF03235 * DUF262 1.9e-16 35.4 48/224  
:BLT:SWISS 21->64 Y686_METJA 6e-04 36.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57388.1 GT:GENE ABA57388.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(957424..957693) GB:FROM 957424 GB:TO 957693 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57388.1 GB:DB_XREF GI:76882707 LENGTH 89 SQ:AASEQ MKNQKESIRKMVSYLNNDEKDGGYWLPNIQRPFVWSEDQIERLFDSIMREYPISTLLVWRTKAEIRHRKFVDNYKQGLRLTDFYVPENN GT:EXON 1|1-89:0| BL:SWS:NREP 1 BL:SWS:REP 21->64|Y686_METJA|6e-04|36.4|44/100| RP:PFM:NREP 1 RP:PFM:REP 21->64|PF03235|2e-10|52.3|44/200|DUF262| HM:PFM:NREP 1 HM:PFM:REP 15->63|PF03235|1.9e-16|35.4|48/224|DUF262| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------1-------------------------------------------------1----1---------------------------------------------------------------------------------------------------------------------------------------------------1--1---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 83-89| PSIPRED cccHHHHHHHHHHHHHHHHHcccEEcccccccccccHHHHHHHHHHHHccccccEEEEEEccccccHHHHHHcccccccccccEEcccc //