[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57410.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:101 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->58 PF11712 * Vma12 0.0003 29.5 44/142  
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57410.1 GT:GENE ABA57410.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(980135..980440) GB:FROM 980135 GB:TO 980440 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA57410.1 GB:DB_XREF GI:76882729 LENGTH 101 SQ:AASEQ MASPPAPDKPKMPSKSLNARLERLEQEQAAREEAVKRQTQEKKQQAIRKHNCEAAHKNLELYRGNPRLRIGDGSGNYTRLNEEERHAHITEAKQQIEANCD GT:EXON 1|1-101:0| COIL:NAA 28 COIL:NSEG 1 COIL:REGION 17->44| SEG 19->34|arlerleqeqaareea| HM:PFM:NREP 1 HM:PFM:REP 5->58|PF11712|0.0003|29.5|44/142|Vma12| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-49| PSIPRED cccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHHHHHHcc //