[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57427.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.4.1
:264 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  108->244 1qjpA  f.4.1.1 * 4e-07 13.7 %
:HMM:SCOP  108->264 1p4tA_ f.4.1.1 * 6.5e-12 22.7 %
:HMM:PFM   22->69 PF10046 * BLOC1_2 0.00011 33.3 48/99  
:PROS 1->4|PS00228|TUBULIN_B_AUTOREG
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57427.1 GT:GENE ABA57427.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1007094..1007888) GB:FROM 1007094 GB:TO 1007888 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA57427.1 GB:DB_XREF GI:76882746 InterPro:IPR002453 LENGTH 264 SQ:AASEQ MREIIIIPLLIIIALFFSPIASSEQSTSVLEKRVQQMEEELRRLRGELVQIQEEEQQVERLEKQVAKVERKKSSQAGGHMVFFRGGYTELNDPRTGQVLTDLGTGANNDDNGWYVGGGFDFLLSDDVWGLWDGASILAELGLEYKHFGSRSQPTALSVLAKPSPETGDTELTMLTVSASPKIKFTQWGKFQPWIIPAGLDIHVISPPSDPVTVLDVGFQVGAGAEYMIWKALKVGVDGRWHWTDDQTLTDNQFWTVGGYLGIGF GT:EXON 1|1-264:0| PROS 1->4|PS00228|TUBULIN_B_AUTOREG|PDOC00200| COIL:NAA 59 COIL:NSEG 1 COIL:REGION 20->78| TM:NTM 1 TM:REGION 4->26| SEG 4->23|iiiiplliiialffspiass| SEG 38->65|eeelrrlrgelvqiqeeeqqverlekqv| HM:PFM:NREP 1 HM:PFM:REP 22->69|PF10046|0.00011|33.3|48/99|BLOC1_2| RP:SCP:NREP 1 RP:SCP:REP 108->244|1qjpA|4e-07|13.7|124/137|f.4.1.1| HM:SCP:REP 108->264|1p4tA_|6.5e-12|22.7|150/0|f.4.1.1|1/1|OMPA-like| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 26-28, 30-36, 53-76| PSIPRED ccEEEHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccHHHcccccccEEEEEcccccccccccEEEEccEEEccccccccccccHHHHHHHHHHHHHHcccccccEEEEEEcccccccEEEEEEEEEEEccEEEEEccccEEcEEEEcccEEEEEccccccEEEEEccEEEEcccHHHHHHHEEEEccEEEEEEccEEEEccccEEEEEEEEEcc //