[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57441.1
DDBJ      :             putative integrase DNA protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:42 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->42 2khvA PDBj 2e-08 47.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57441.1 GT:GENE ABA57441.1 GT:PRODUCT putative integrase DNA protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1027217..1027345) GB:FROM 1027217 GB:TO 1027345 GB:DIRECTION - GB:PRODUCT putative integrase DNA protein GB:PROTEIN_ID ABA57441.1 GB:DB_XREF GI:76882760 LENGTH 42 SQ:AASEQ MIGAIRVNAITTEDILKILSPIWTTKTETAKRVQGRMENILD GT:EXON 1|1-42:0| BL:PDB:NREP 1 BL:PDB:REP 1->42|2khvA|2e-08|47.6|42/106| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 42 STR:RPRED 100.0 SQ:SECSTR HHTTcccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHH PSIPRED ccccccHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHc //