[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57454.1
DDBJ      :             Periplasmic protein thiol-disulfide oxidoreductase DsbE
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  382/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:177 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   60->167 1kngA PDBj 2e-28 46.3 %
:RPS:PDB   29->177 2b1kA PDBj 4e-21 40.5 %
:RPS:SCOP  54->177 1z5yE1  c.47.1.10 * 6e-38 45.5 %
:HMM:SCOP  39->171 1z5yE1 c.47.1.10 * 1.7e-32 34.6 %
:RPS:PFM   38->155 PF08534 * Redoxin 3e-21 40.9 %
:HMM:PFM   36->157 PF08534 * Redoxin 1.2e-18 21.7 120/146  
:BLT:SWISS 3->160 DSBE_CHRVI 3e-44 50.3 %
:PROS 64->82|PS00194|THIOREDOXIN_1
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57454.1 GT:GENE ABA57454.1 GT:PRODUCT Periplasmic protein thiol-disulfide oxidoreductase DsbE GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1040816..1041349) GB:FROM 1040816 GB:TO 1041349 GB:DIRECTION - GB:PRODUCT Periplasmic protein thiol-disulfide oxidoreductase DsbE GB:PROTEIN_ID ABA57454.1 GB:DB_XREF GI:76882773 InterPro:IPR004799 InterPro:IPR006662 InterPro:IPR006663 InterPro:IPR011594 LENGTH 177 SQ:AASEQ MLRYTIPLIIFTALVLFFAVGLQRDPRQVPSPFIDKPAPELGVSQLRTPSKEIYRSDLLGKPALINVWASWCVACRAEHEVLMRLARETRLPIIGLNYKDERGAALQWLANLGDPYAAIAVDTDGQVGIEWGVYGVPESFLLDPEGVIRYKQIGPLTWKVVEDKLLPLIRSFETQGG GT:EXON 1|1-177:0| BL:SWS:NREP 1 BL:SWS:REP 3->160|DSBE_CHRVI|3e-44|50.3|157/165| PROS 64->82|PS00194|THIOREDOXIN_1|PDOC00172| TM:NTM 1 TM:REGION 2->24| BL:PDB:NREP 1 BL:PDB:REP 60->167|1kngA|2e-28|46.3|108/144| RP:PDB:NREP 1 RP:PDB:REP 29->177|2b1kA|4e-21|40.5|148/149| RP:PFM:NREP 1 RP:PFM:REP 38->155|PF08534|3e-21|40.9|115/132|Redoxin| HM:PFM:NREP 1 HM:PFM:REP 36->157|PF08534|1.2e-18|21.7|120/146|Redoxin| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08534|IPR013740| RP:SCP:NREP 1 RP:SCP:REP 54->177|1z5yE1|6e-38|45.5|123/136|c.47.1.10| HM:SCP:REP 39->171|1z5yE1|1.7e-32|34.6|130/0|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 503 OP:NHOMOORG 383 OP:PATTERN -------------------------------------------------------------------- ---1-------------------------------------111------------------3------------------------------------------3---2--------------------------33333---22-------------------------------------11234-1-121111111321232113-111-1322-31-112------21------------------------------------------------------------------------------------------1-1-1-----------------------2----------1------1---21-111111111111111111111111111111111-11111111112-111112211111111124111111112111111111111111111111111---------------------111211-11-2-----------------------111221111-11----212--121-----1-------121111---------------1-11111-1----11-----------------------------22-122111111111111111111111111---1123------11--1-11111111111-111111111111111111111111---2222222222222222111111111-111111111111---2-----1111311-2222222222222112-------1211211111111111111111---------12222111112222211222222231111-11-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 172 STR:RPRED 97.2 SQ:SECSTR #####TEEEEEETTcccEcccccccccccccTTTTccccccEEEEcccTTcEEEGGGGccccEEEEEEcTTcHHHHHHHHHHHHHHHHTTccEEEEEEcccHHHHHHHHHHHcccccEEEEETTcHHHHHHTcccccEEEEEcTTccEEEEEEccccHHHHHHTTHHHHHHHHHHHc DISOP:02AL 174-177| PSIPRED cHHHHHHHHHHHHHHHHHHHHHcccHHccccccccccccccccccccccccEEEHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHccccccEEEEcccHHHHHHcccccccEEEEEccccEEEEEEEccccHHHHHHHHHHHHHHHHHccc //