[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57458.1
DDBJ      :             Cytochrome c-type biogenesis protein CcmB
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  223/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:234 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   20->115 PF03379 * CcmB 2e-19 49.0 %
:HMM:PFM   20->229 PF03379 * CcmB 6.7e-78 60.0 210/215  
:BLT:SWISS 20->115 CCMB_HAEIN 1e-22 56.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57458.1 GT:GENE ABA57458.1 GT:PRODUCT Cytochrome c-type biogenesis protein CcmB GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1044919..1045623) GB:FROM 1044919 GB:TO 1045623 GB:DIRECTION - GB:PRODUCT Cytochrome c-type biogenesis protein CcmB GB:PROTEIN_ID ABA57458.1 GB:DB_XREF GI:76882777 InterPro:IPR003544 LENGTH 234 SQ:AASEQ MTSLALPMNASTLSHACWWLTKRDLLLVLRHRSDAANPLLFFLMVASIFPLGIGPESGVLRQIAPGIIWIAALLATLLSLEAMFRSDFDDGSLEQLILSPHPLPILVLAKIFAHWLATGLPLILLAPLLGLIFGISGWPLVILLITLLVGTPALSLVGAVGVALTVGLRRGGLLLTLLLLPLYVPILIFSAGAVETAAQGLPADGQLYLLGALLVLAATLAPIATSAALCIRMS GT:EXON 1|1-234:0| BL:SWS:NREP 1 BL:SWS:REP 20->115|CCMB_HAEIN|1e-22|56.2|96/221| TM:NTM 6 TM:REGION 35->57| TM:REGION 63->85| TM:REGION 107->129| TM:REGION 142->164| TM:REGION 172->194| TM:REGION 209->231| SEG 71->82|aallatllslea| SEG 116->132|latglplillapllgli| SEG 137->188|gwplvillitllvgtpalslvgavgvaltvglrrggllltllllplyvpili| SEG 207->229|lyllgallvlaatlapiatsaal| RP:PFM:NREP 1 RP:PFM:REP 20->115|PF03379|2e-19|49.0|96/214|CcmB| HM:PFM:NREP 1 HM:PFM:REP 20->229|PF03379|6.7e-78|60.0|210/215|CcmB| GO:PFM:NREP 4 GO:PFM GO:0015232|"GO:heme transporter activity"|PF03379|IPR003544| GO:PFM GO:0015886|"GO:heme transport"|PF03379|IPR003544| GO:PFM GO:0016020|"GO:membrane"|PF03379|IPR003544| GO:PFM GO:0017004|"GO:cytochrome complex assembly"|PF03379|IPR003544| OP:NHOMO 239 OP:NHOMOORG 223 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11------1----11------------1111111111--111111111111-----1-1-------11111111111111-1---------------------------------------1-----------------------1--121111-11----1-1----1-----1-------121111-----------------------------------------------------------11-111111111111111111111111111---1-1-------11--1-11111111111-1111111111111111111---11---222-22222222222111111111--111111111111---1---------1-1-1111111111111111-------1111111111111111111111----------11111111111111--------------11--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHccccccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //