[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57463.1
DDBJ      :             Glyoxalase/bleomycin resistance protein/dioxygenase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:132 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->90 1q0oA PDBj 1e-06 39.2 %
:RPS:PDB   3->126 3bt3A PDBj 5e-19 18.5 %
:RPS:SCOP  9->124 1bylA  d.32.1.2 * 2e-17 13.0 %
:HMM:SCOP  1->126 1kw3B2 d.32.1.3 * 5e-28 36.9 %
:RPS:PFM   10->122 PF00903 * Glyoxalase 2e-10 36.4 %
:HMM:PFM   9->122 PF00903 * Glyoxalase 3.4e-20 27.2 114/128  
:BLT:SWISS 5->123 FOSB_BREBN 6e-07 34.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57463.1 GT:GENE ABA57463.1 GT:PRODUCT Glyoxalase/bleomycin resistance protein/dioxygenase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1050595..1050993) GB:FROM 1050595 GB:TO 1050993 GB:DIRECTION - GB:PRODUCT Glyoxalase/bleomycin resistance protein/dioxygenase GB:PROTEIN_ID ABA57463.1 GB:DB_XREF GI:76882782 InterPro:IPR004360 InterPro:IPR011588 LENGTH 132 SQ:AASEQ MNKPPATAGLRHVALFVSDLDACENFYVELLGMRVEWRPDPDNVYLTSGNDSLALHRTPPDQLPEGPQRLDHMGFAIRTPEAIDAWYEYLKAQHVPIKTMPRTHRDGARSFYCTDPAGTILQLIYHSSFTAK GT:EXON 1|1-132:0| BL:SWS:NREP 1 BL:SWS:REP 5->123|FOSB_BREBN|6e-07|34.5|116/141| BL:PDB:NREP 1 BL:PDB:REP 12->90|1q0oA|1e-06|39.2|74/356| RP:PDB:NREP 1 RP:PDB:REP 3->126|3bt3A|5e-19|18.5|124/129| RP:PFM:NREP 1 RP:PFM:REP 10->122|PF00903|2e-10|36.4|107/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 9->122|PF00903|3.4e-20|27.2|114/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 9->124|1bylA|2e-17|13.0|115/122|d.32.1.2| HM:SCP:REP 1->126|1kw3B2|5e-28|36.9|122/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 41 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------1111111111------------------11111111----1---1--11----111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------1-1-----------------------------------------------------------------------------------------------------------1--1--------------------------------------------------------------------------------------------1-----------------------------------------11111---11111----------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 132 STR:RPRED 100.0 SQ:SECSTR cTcccccccccccEEEEccHHHHHHHHHHTTccEEEEEEEcTTccEEEcccTTTTcccccccEEEEEccccccEEEEEEcccHHHHHHHHHHTTcccccccEEETTTEEEEEEEcTTccEEEEEEEcccccc DISOP:02AL 1-3, 130-132| PSIPRED ccccccccEEEEEEEEEccHHHHHHHHHHHHccEEEEEccccEEEEEEcccEEEEEEccccccccccccccEEEEEEccHHHHHHHHHHHHHcccEEEEcccccccccEEEEEEcccccEEEEEEccccccc //