[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57467.1
DDBJ      :             Conserved hypothetical protein 255
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  520/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:288 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   79->265 2q9fA PDBj 4e-04 26.0 %
:RPS:PFM   2->155 PF03755 * YicC_N 3e-21 40.3 %
:RPS:PFM   204->288 PF08340 * DUF1732 2e-24 68.2 %
:HMM:PFM   2->155 PF03755 * YicC_N 2.7e-48 42.9 154/159  
:HMM:PFM   203->288 PF08340 * DUF1732 8.5e-38 60.5 86/87  
:BLT:SWISS 1->288 YICC_ECOLI 4e-72 47.0 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57467.1 GT:GENE ABA57467.1 GT:PRODUCT Conserved hypothetical protein 255 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1055072..1055938 GB:FROM 1055072 GB:TO 1055938 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein 255 GB:PROTEIN_ID ABA57467.1 GB:DB_XREF GI:76882786 InterPro:IPR005229 LENGTH 288 SQ:AASEQ MIYSMTAFARQEAQSDVGTFTWELRSVNHRYLDISVRLPEELRFIESQLRTQVGCRLKRGKVDCTLRYLPPSEQAPKFSLNEQVTRQLVQLCEEIEALSHNPAPLNSLEVLRWPGVLQTPPVDGEQLKIGALSALEEALNQMLETRAAEGRRLAAFITQRCEEIEAIIVRVRAHLPQAMLHFRERLLARLEVVQADLEQGRIEQELVLFAQKSDITEELDRLQSHMAEVREVFQRKEPIGRRLDFLMQELNREANTLAAKSADVEISQDAVELKVLIEQVREQIQNIE GT:EXON 1|1-288:0| BL:SWS:NREP 1 BL:SWS:REP 1->288|YICC_ECOLI|4e-72|47.0|287/287| COIL:NAA 16 COIL:NSEG 1 COIL:REGION 260->275| BL:PDB:NREP 1 BL:PDB:REP 79->265|2q9fA|4e-04|26.0|177/433| RP:PFM:NREP 2 RP:PFM:REP 2->155|PF03755|3e-21|40.3|154/158|YicC_N| RP:PFM:REP 204->288|PF08340|2e-24|68.2|85/86|DUF1732| HM:PFM:NREP 2 HM:PFM:REP 2->155|PF03755|2.7e-48|42.9|154/159|YicC_N| HM:PFM:REP 203->288|PF08340|8.5e-38|60.5|86/87|DUF1732| OP:NHOMO 524 OP:NHOMOORG 521 OP:PATTERN -------------------------------------------------------------------- 111--------------------------------------------------------------------------------21111111111111--11111111111--------------111111111111----------------------------------------------------11-111111111111111111-111111111111---1111111---------------------1---------------------------------------------------------------------11111111111111111111111111-111111111111-1111111-1-1111111-----111111111111111111-11111-11111111111-1111111111111111111-1111111--------1----111-----------------------------------11-111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111-------------------------111111111111111111111111111211121-11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111----------1111111111111111111---------11111111111111111111111111111--1-------11111-111---------------------------1111111111-11 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 177 STR:RPRED 61.5 SQ:SECSTR ##############################################################################HTHHHHHHHHHHHHHHHHTTTTTTccEEHHHHHHHHHHHHHHHHccccGGGTccHHHHHHHHHHHHHHHHTcTTTcccccTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccH####HHHHHHHTTTccccHHHHHHH######HHHHHHTTHHHHHHHHHHHHHHTTcHHHHHHHHHHHH####################### DISOP:02AL 288-289| PSIPRED ccccccHHHEEEEEcccEEEEEEEEEccccccEEEEEccHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEccccccccEEcHHHHHHHHHHHHHHHHHccccccccHHHHHccccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //