[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57476.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:148 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->55 PF02340 * PRRSV_Env 0.00094 22.5 40/234  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57476.1 GT:GENE ABA57476.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1067483..1067929 GB:FROM 1067483 GB:TO 1067929 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57476.1 GB:DB_XREF GI:76882795 LENGTH 148 SQ:AASEQ MFYNPKRESEPLQRQWSAHQESVCTYAAEQLIFLDEMGAVFNLSLDYAPKGQRVYDEKPTAKGERISTLGVLSLQGLVTGMRFEDTLNGSVFLYFLEQFLCPPLKPGQCVILDNAAAYKAEGGAEPMSKLALDSFTCLPIFQILTPLK GT:EXON 1|1-148:0| HM:PFM:NREP 1 HM:PFM:REP 16->55|PF02340|0.00094|22.5|40/234|PRRSV_Env| OP:NHOMO 69 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------D55B---7--------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------4------------------------------------4----------------3------------------------------------------------------4-------------------1----------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------8------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 148-149| PSIPRED ccccHHHccHHHHHHHHHHHHHHHccccccEEEEEHHHccccccEEHHccccccEEEEccccccEEEEEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHcccEEEEcccccccccccc //