[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57480.1
DDBJ      :             Electron transport complex, RnfABCDGE type, A subunit
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  288/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:193 amino acids
:PSIPRED
:RPS:PFM   26->191 PF02508 * Rnf-Nqr 5e-38 58.4 %
:HMM:PFM   1->191 PF02508 * Rnf-Nqr 2.3e-74 54.0 189/190  
:BLT:SWISS 1->192 RNFA_THISH 1e-81 84.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57480.1 GT:GENE ABA57480.1 GT:PRODUCT Electron transport complex, RnfABCDGE type, A subunit GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1070633..1071214) GB:FROM 1070633 GB:TO 1071214 GB:DIRECTION - GB:PRODUCT Electron transport complex, RnfABCDGE type, A subunit GB:PROTEIN_ID ABA57480.1 GB:DB_XREF GI:76882799 InterPro:IPR003667 InterPro:IPR011293 LENGTH 193 SQ:AASEQ MSEYALILVSTVLVNNFVLVKFLGLCPFMGVSRKLETAIGMGLATTFVLTLSSVCSYLINEYLLTPLGIEYLRTIAFILAIAFVVQFTEMVVHKTSPLLYQVLGIFLPLITTNCAVLGVALLNIQHQHGFLSSALYGFGAAVGFSLVLILFAALRERIAAAEVPQPFQGPAIGLITAGLMSMAFMGFAGLVKG GT:EXON 1|1-193:0| BL:SWS:NREP 1 BL:SWS:REP 1->192|RNFA_THISH|1e-81|84.9|192/192| TM:NTM 6 TM:REGION 6->28| TM:REGION 37->59| TM:REGION 71->93| TM:REGION 101->123| TM:REGION 131->153| TM:REGION 167->189| SEG 12->25|vlvnnfvlvkflgl| RP:PFM:NREP 1 RP:PFM:REP 26->191|PF02508|5e-38|58.4|161/187|Rnf-Nqr| HM:PFM:NREP 1 HM:PFM:REP 1->191|PF02508|2.3e-74|54.0|189/190|Rnf-Nqr| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF02508|IPR003667| OP:NHOMO 618 OP:NHOMOORG 291 OP:PATTERN -------------------------------------------------21----------------- --------------------------------------------------------------------------------2-------3333-333----1--11-----111111111111112---2-322-23----------------------------------------------------22--------------------------------------------------------------------------------------------------------------------------------------32-22222222-2--122222-22223221--------24--11---2---1------------------------------------------------------------------2222-11-------------2------------------------------------2---------------------------------------------------41-2--422222222--344-24422222-522---------2-------11---------------------------444332332234544433344454433543--3115121-11111221111111111111-1111111111111111111333112221111111111111111211111111-233333233333---4---------53313333333233333333-------111533323-11-2----5------------133323333333333--------------2212--------------2-1-------------------------3233223222--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccHHHHHHHHHHHHHHHHHHccccc //