[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57485.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:232 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57485.1 GT:GENE ABA57485.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1077576..1078274) GB:FROM 1077576 GB:TO 1078274 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57485.1 GB:DB_XREF GI:76882804 InterPro:IPR002197 LENGTH 232 SQ:AASEQ METGEMILVGTIAFIAIVSVALIYAWFSLNGLIKAAIERYGTQITQTRVQISTVKIAPTAGGGTISRLTISNPPGFSSSSLIALDTISIKIDASTLRQNPIIIKEIIFHSPQVFFEISLSGKSNIGVLRKNIVTAGEFIPLRLKQTGKKEIKLVIQRLTIEEGQIHAAISGLEGRQLTGKLPRLELTDIGNEKGGFSPKEMAEEIIAALINPVDSAASKLRAKTEEYLRHAL GT:EXON 1|1-232:0| TM:NTM 1 TM:REGION 9->31| OP:NHOMO 9 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------1--------------1-----------------------------------------1--1------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 132-153, 217-218, 220-221| PSIPRED cccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEEEccccEEEEEEEEcccccccccccEEEEEEEEEEEccccccccEEEEEEEEEccEEEEEEEccccHHHHHHHHHHHcccccHHHHHHHHcccEEEEEEEEEEEEccEEEEEEEccccccEEEEccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //