[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57486.1
DDBJ      :             Protein of unknown function DUF1499
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  72/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
:133 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   18->122 PF07386 * DUF1499 5e-17 42.7 %
:HMM:PFM   14->126 PF07386 * DUF1499 6.9e-38 38.9 113/118  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57486.1 GT:GENE ABA57486.1 GT:PRODUCT Protein of unknown function DUF1499 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1078727..1079128) GB:FROM 1078727 GB:TO 1079128 GB:DIRECTION - GB:PRODUCT Protein of unknown function DUF1499 GB:PROTEIN_ID ABA57486.1 GB:DB_XREF GI:76882805 InterPro:IPR010865 LENGTH 133 SQ:AASEQ MEKDEMQSPPNNEFPPCPTNPNCVCSDSAIKDEKHYIEPYHLKVSPPEGWGVLKDIISALPRTTIISASSHYLHAIAKSRIFRFVDDLEFQLRPRQKMIALRSAARLGYYDFGVNRNRIEKIRNQLRLQGVIR GT:EXON 1|1-133:0| RP:PFM:NREP 1 RP:PFM:REP 18->122|PF07386|5e-17|42.7|103/116|DUF1499| HM:PFM:NREP 1 HM:PFM:REP 14->126|PF07386|6.9e-38|38.9|113/118|DUF1499| OP:NHOMO 101 OP:NHOMOORG 83 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------111----1----------221-221-----1111-11--1221221122222122----------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1--------------------1111111-11111----1-1------------------------------------------------1------1---------------1----------------------------------------------------------------------------------------------------------11-2------------------------------------------------------11111111111111------------------11----------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----1-11121-21------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-16| PSIPRED ccccccccccccccccccccccEEEEcccccccccccccEEEEccHHHHHHHHHHHHHHccccEEEEEcccEEEEEEEEEEEccccEEEEEEEccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHccccc //