[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57489.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.39.1b.80.1
:114 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   13->100 1dabA PDBj 7e-06 9.8 %
:RPS:SCOP  55->97 1dabA  b.80.1.7 * 9e-06 14.0 %
:HMM:SCOP  40->108 2sasA_ a.39.1.5 * 6.3e-06 39.1 %
:HMM:PFM   81->100 PF00036 * efhand 1.5e-06 50.0 20/29  
:HMM:PFM   8->31 PF04246 * RseC_MucC 0.0007 33.3 24/135  
:BLT:SWISS 45->97 S10A7_HORSE 1e-04 34.0 %
:PROS 85->97|PS00018|EF_HAND_1
:TM
:REPEAT 2|43->68|69->94

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57489.1 GT:GENE ABA57489.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1082062..1082406) GB:FROM 1082062 GB:TO 1082406 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57489.1 GB:DB_XREF GI:76882808 InterPro:IPR002048 LENGTH 114 SQ:AASEQ MNQRIFPIKSINKRAFLIYVIPLSGILLSMNLYAEQHSPQLSEEQEQWIARPPTFSELDKNLDNYLSKEEAKSWEKLYSKFDEVDKNGDQKIDRTEFNDFETHLIEESILEFTE GT:EXON 1|1-114:0| BL:SWS:NREP 1 BL:SWS:REP 45->97|S10A7_HORSE|1e-04|34.0|53/101| PROS 85->97|PS00018|EF_HAND_1|PDOC00018| TM:NTM 1 TM:REGION 15->34| NREPEAT 1 REPEAT 2|43->68|69->94| RP:PDB:NREP 1 RP:PDB:REP 13->100|1dabA|7e-06|9.8|82/539| HM:PFM:NREP 2 HM:PFM:REP 81->100|PF00036|1.5e-06|50.0|20/29|efhand| HM:PFM:REP 8->31|PF04246|0.0007|33.3|24/135|RseC_MucC| RP:SCP:NREP 1 RP:SCP:REP 55->97|1dabA|9e-06|14.0|43/539|b.80.1.7| HM:SCP:REP 40->108|2sasA_|6.3e-06|39.1|64/185|a.39.1.5|1/1|EF-hand| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 87.7 SQ:SECSTR ######cccccccccccccEEEEEEEEEEEccEEEEcccTTTcccEEEEEEcTHEEEEETEEEEEEccEEEcTTETTcEEEEEccEEccccEEEEcccccHHHHHH######## DISOP:02AL 1-3, 38-47| PSIPRED ccccccccccccccEEEEEEEcHHHHHHHHHHHHHHccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcc //