[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57516.1
DDBJ      :             stress protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  93/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
d.209.1
:195 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   21->181 3ibzA PDBj 9e-36 49.7 %
:RPS:PDB   1->175 2a5iA PDBj 5e-35 9.9 %
:RPS:SCOP  48->132 1jbiA  d.209.1.1 * 1e-21 17.9 %
:RPS:PFM   69->181 PF02342 * TerD 7e-31 50.4 %
:HMM:PFM   69->188 PF02342 * TerD 2.6e-39 41.2 119/128  
:HMM:PFM   3->58 PF10138 * Tellurium_res 7.3e-09 32.7 55/99  
:BLT:SWISS 3->187 TERZ_SERMA 3e-47 56.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57516.1 GT:GENE ABA57516.1 GT:PRODUCT stress protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1114718..1115305 GB:FROM 1114718 GB:TO 1115305 GB:DIRECTION + GB:PRODUCT stress protein GB:PROTEIN_ID ABA57516.1 GB:DB_XREF GI:76882835 InterPro:IPR003325 LENGTH 195 SQ:AASEQ MPVKLVKGQKISLEKESGGALSKVVMGLGWDAAGTGKKGFFGFGGGGQQIDLDASCVLFDESGNVLDTVWFRQLQSKDGSITHTGDNLTGEGEGDDEQIIVDLTRIPASVKSLVFVVNSFTGQNFGQVENAFCRLVNHSDNAEIARYDLSCQGNHSAQVMAKIYRHNNDWKMHAIGENASGRTFNDLLPAIRPHL GT:EXON 1|1-195:0| BL:SWS:NREP 1 BL:SWS:REP 3->187|TERZ_SERMA|3e-47|56.6|182/193| SEG 34->47|gtgkkgffgfgggg| BL:PDB:NREP 1 BL:PDB:REP 21->181|3ibzA|9e-36|49.7|151/176| RP:PDB:NREP 1 RP:PDB:REP 1->175|2a5iA|5e-35|9.9|161/306| RP:PFM:NREP 1 RP:PFM:REP 69->181|PF02342|7e-31|50.4|113/125|TerD| HM:PFM:NREP 2 HM:PFM:REP 69->188|PF02342|2.6e-39|41.2|119/128|TerD| HM:PFM:REP 3->58|PF10138|7.3e-09|32.7|55/99|Tellurium_res| GO:PFM:NREP 1 GO:PFM GO:0006950|"GO:response to stress"|PF02342|IPR003325| RP:SCP:NREP 1 RP:SCP:REP 48->132|1jbiA|1e-21|17.9|78/100|d.209.1.1| OP:NHOMO 338 OP:NHOMOORG 98 OP:PATTERN -------------------------------------------------------------------- ------------------------------------5443-5543-----------------1----899-----------------------------------3---2-------------------------------------4--33-----------2-----14--------------3-------3333333333333333--3343333---3---------4----------------------------------------------3----------------------------------------------32------------5114----4----------73--------------------------------------------------------------------------------------------------------3-------------------------------------------1-----------------42----------------4------1----------------4-----------------------------------------------------------------------6----------------------2----------4------36----4---3---------3---------44----3---------------------------44444444444------------------------------3--------4444----------------333------------------------------------------------------------------------------------------------- ----61------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------1----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 181 STR:RPRED 92.8 SQ:SECSTR EEccccTTcEEEEEEEETTEEEEEEccTTccccccccTTcTTcEEEEEEEETTEEEEEEEEEEEcTTcccccccccccccccccccccccHHHHHHHHHHHHHTTccTTcccccccHHHHHTcccccHHHHHHTHHHHHHTccHHHHHHHHHHHHHcEEEEEEHHHHHccTTcccEEETTH############## PSIPRED ccEEEEcccEEEEEEcccccEEEEEEEEcccccccccccccccccccccccEEEEEEEEcccccEEEEEEcccccccccEEEEcccccccccccccEEEEEEHHHccccccEEEEEEEEcccccHHHccccEEEEEEccccEEEEEEEcccccccEEEEEEEEEEEcccEEEEEEEcccccccHHHHHHHHHHcc //