[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57521.1
DDBJ      :             3-isopropylmalate dehydratase, small subunit
Swiss-Prot:LEUD_NITOC   RecName: Full=3-isopropylmalate dehydratase small subunit;         EC=4.2.1.33;AltName: Full=Isopropylmalate isomerase;AltName: Full=Alpha-IPM isomerase;         Short=IPMI;

Homologs  Archaea  31/68 : Bacteria  684/915 : Eukaryota  101/199 : Viruses  0/175   --->[See Alignment]
c.8.2
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->184 2hcuA PDBj 1e-39 50.9 %
:RPS:PDB   1->186 1c96A PDBj 7e-48 20.5 %
:RPS:SCOP  1->177 1l5jA2  c.8.2.1 * 5e-43 19.3 %
:HMM:SCOP  1->204 1acoA1 c.8.2.1 * 1.3e-60 46.0 %
:RPS:PFM   26->128 PF00694 * Aconitase_C 8e-15 45.4 %
:HMM:PFM   1->132 PF00694 * Aconitase_C 1.8e-41 44.4 126/131  
:BLT:SWISS 1->214 LEUD_NITOC e-126 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57521.1 GT:GENE ABA57521.1 GT:PRODUCT 3-isopropylmalate dehydratase, small subunit GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1121378..1122022 GB:FROM 1121378 GB:TO 1122022 GB:DIRECTION + GB:PRODUCT 3-isopropylmalate dehydratase, small subunit GB:PROTEIN_ID ABA57521.1 GB:DB_XREF GI:76882840 InterPro:IPR000573 InterPro:IPR004431 LENGTH 214 SQ:AASEQ MEPLTVVEGLVVPLDRANVDTDAIIPKQFLKSIKRTGFGPNLFDEWRYLDHGEPGKDCRHRPLNPEFVLNQPRYQGANILLARDNFGCGSSREHAVWALVDDGFRVVIAPSFADIFHSNAFKNGLLPIILDEDSVTTLFKDTEATLGYRLRIDLPAQEVTTPEGKVMPFTIDEFRKHCLMEGLDEIGLTLQYRDEIRAYEERRQVEAPWLFEKG GT:EXON 1|1-214:0| SW:ID LEUD_NITOC SW:DE RecName: Full=3-isopropylmalate dehydratase small subunit; EC=4.2.1.33;AltName: Full=Isopropylmalate isomerase;AltName: Full=Alpha-IPM isomerase; Short=IPMI; SW:GN Name=leuD; OrderedLocusNames=Noc_1013; SW:KW Amino-acid biosynthesis; Branched-chain amino acid biosynthesis;Complete proteome; Leucine biosynthesis; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->214|LEUD_NITOC|e-126|100.0|214/214| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009082|"GO:branched chain family amino acid biosynthetic process"|Branched-chain amino acid biosynthesis| GO:SWS GO:0009098|"GO:leucine biosynthetic process"|Leucine biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| BL:PDB:NREP 1 BL:PDB:REP 1->184|2hcuA|1e-39|50.9|169/177| RP:PDB:NREP 1 RP:PDB:REP 1->186|1c96A|7e-48|20.5|166/753| RP:PFM:NREP 1 RP:PFM:REP 26->128|PF00694|8e-15|45.4|97/130|Aconitase_C| HM:PFM:NREP 1 HM:PFM:REP 1->132|PF00694|1.8e-41|44.4|126/131|Aconitase_C| GO:PFM:NREP 1 GO:PFM GO:0008152|"GO:metabolic process"|PF00694|IPR000573| RP:SCP:NREP 1 RP:SCP:REP 1->177|1l5jA2|5e-43|19.3|161/212|c.8.2.1| HM:SCP:REP 1->204|1acoA1|1.3e-60|46.0|198/0|c.8.2.1|1/1|LeuD/IlvD-like| OP:NHOMO 926 OP:NHOMOORG 816 OP:PATTERN ---------------1--------1--111212121111111-222-1--221111-----1--1-22 1111111111111111111-111111111111111111221111111--111111111--111111111111111111-11-21--1-111111---11--1-1111111----------------11111111-1111111-11111111111111111111111111111111111111111111111-11111111111111111111111111111111--11111111-1111111111111111111-------1------------1111-1-------11111111111111-------------111111111-12--1-------1-12-------1-1--1-1-1--1-11111-1111--1-112111-----212221111111111111111111-11211311111-1112111111112143122111111121111111111111111-----------------------------111311143231112111111111211111-1214214311221111111111122211111211111111111111--211111111111-11111111211111112-111111111--1--------1--1111111111-2111111111111111111111-1-1111-11--111111111111111111-11-1111111111111111111111112121212222212112111111111-11111111111111-1---------11111111112-11111111111111111121111111221112111111-1-11-1-111111111111111111111111111111111221111--------------------------------------1--------11 --------------11111122222121111111111111-111111-12112111221111111111-11211111-1111111111-11111111111111112--1---------------------------------------------------------------------1911-------1-11122221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 203 STR:RPRED 94.9 SQ:SECSTR HHHcccGGGGGGTccHHHHGGGcTTTcccTTTcccccEEcTTTccEEccccEEcTTTccEEcTHHHHHHHHHHHTccEEEEcccccTcccccTHHHHHHHHTTEEEEEEccccHHHHHHHHHTTcEEEEEccGGGGGGccTTccccccEEEEEcGGGEEEcTTccEEHHHHHHHHHTcHHHHHHHHHHHHHHHTcHHHHHHHH########### DISOP:02AL 214-215| PSIPRED cccEEEEEEEEEEEEcccccHHHcccHHHcccccHHHHcccccHHHHHHcccccccccccccccccccccHHHHccccEEEEEccccccccHHHHHHHHHHcccEEEEEccHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHcccccEEEEEccccEEEcccccEEEEEccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccc //