[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57530.1
DDBJ      :             acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha
Swiss-Prot:             

Homologs  Archaea  26/68 : Bacteria  810/915 : Eukaryota  42/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:286 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->285 2f9yB PDBj 2e-89 63.4 %
:RPS:PDB   9->60 3cw2M PDBj 4e-07 13.5 %
:RPS:PDB   35->271 3buzA PDBj 1e-46 10.2 %
:RPS:SCOP  26->285 2f9yB1  c.14.1.4 * 2e-71 65.4 %
:HMM:SCOP  26->288 2f9yB1 c.14.1.4 * 8.7e-83 41.1 %
:RPS:PFM   56->242 PF01039 * Carboxyl_trans 5e-41 52.0 %
:HMM:PFM   106->242 PF01039 * Carboxyl_trans 1.6e-20 33.3 135/493  
:HMM:PFM   27->63 PF00684 * DnaJ_CXXCXGXG 0.001 20.0 35/79  
:BLT:SWISS 1->281 ACCD_METCA e-114 71.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57530.1 GT:GENE ABA57530.1 GT:PRODUCT acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1132631..1133491 GB:FROM 1132631 GB:TO 1133491 GB:DIRECTION + GB:PRODUCT acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha GB:PROTEIN_ID ABA57530.1 GB:DB_XREF GI:76882849 InterPro:IPR000438 LENGTH 286 SQ:AASEQ MSWLGKLLPSKIRTEGPKRKSVPEGLWTKCNACDAILYRVELERNMDVCPKCGGHKRISARRRLDVFLDEGPREEIGANLQPLDTLKFKDSKKYKDRLSQTQKVVQENDSLVVMEGHVRGLPLVVAAFEFSFMGGSLGSVAGERFVRGVEAAIEQRIPMVCFSASGGARMQEGLFSLLQMSKTSAALARLNKQGLPFISVLTDPTMGGVSASLAMLGDINIAEPGALIGFAGPRVIEQTVRETLPKGFQRSEFLLAHGVIDMIVDRRDLPDRIAGLLAILTHKPSI GT:EXON 1|1-286:0| BL:SWS:NREP 1 BL:SWS:REP 1->281|ACCD_METCA|e-114|71.2|281/324| BL:PDB:NREP 1 BL:PDB:REP 26->285|2f9yB|2e-89|63.4|254/257| RP:PDB:NREP 2 RP:PDB:REP 9->60|3cw2M|4e-07|13.5|52/138| RP:PDB:REP 35->271|3buzA|1e-46|10.2|225/413| RP:PFM:NREP 1 RP:PFM:REP 56->242|PF01039|5e-41|52.0|171/454|Carboxyl_trans| HM:PFM:NREP 2 HM:PFM:REP 106->242|PF01039|1.6e-20|33.3|135/493|Carboxyl_trans| HM:PFM:REP 27->63|PF00684|0.001|20.0|35/79|DnaJ_CXXCXGXG| GO:PFM:NREP 1 GO:PFM GO:0016874|"GO:ligase activity"|PF01039|IPR000022| RP:SCP:NREP 1 RP:SCP:REP 26->285|2f9yB1|2e-71|65.4|254/257|c.14.1.4| HM:SCP:REP 26->288|2f9yB1|8.7e-83|41.1|263/0|c.14.1.4|1/1|ClpP/crotonase| OP:NHOMO 1140 OP:NHOMOORG 878 OP:PATTERN --1-1-1-111111111-------1112--11----------------------1111111------1 234-1144334-311-111-12--1211111111111422-11211-211111111--112222-3221121111111-1113111112222-3111--1111212122211111111111111121323223232233551112211111111111111111111111111111111111111112211-122111111111111111122222111222321111111121111111111111111111111-111111-1-2211111111111111111111111111111111111111111111111111111111112111111111111121111111111---21111121111121--21111211322211111223222212322222122111122-22322222222122222222232221322212222222211111111111112231111111111--1----1-11-11-1111122111111111111111111111221111-1212121112221212221222221231111111111111111123-11111111121111212111113222221111111111111111111111111111111111111111--------------------1-11111------11121111111111111-1111111111111111111222111111111111111111111111111111111111111111111111111111111111111111111111111122222122112122221222112122222111111111111111111122122112121111111111121--------------1-1-------------------------11111-1111111 ------1-11-1--1-----------------------------------------------------------------------------------------1--1211-1---------1-11-2-571-111-1--------1-----------2----111-----1212211------1---3--1--11112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 277 STR:RPRED 96.9 SQ:SECSTR ########cccccccHHHHccccTcHHHHHHHHHccccccccTTcHHHHHHHHHHHHccHHHHHHHHHHHHTHHHHHHHHHcGGGTcccHHHHHTcHHHHHHHHHHHHHHHHHHccccccEEEEEEcGGGGTcccccccTTcccccHHHHHHHHHHccEEEEEEEccEEEEEEEEEEccccccTTccccccEEEEcTTcccEEEEETTEEEEEEEEEEEEEEEEEEEEEETTEEEEEEEEEEEcccccTTcHHHHHHHHHHHHTTHHHHccHHHHHHHHccccTc# DISOP:02AL 9-24, 285-286| PSIPRED cccHHHHccccccccccccccccccccEEcccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHcccccccEEEEEEEEEccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHcEEEEEEcccEEEEEcHHHHHHHHccHHHHHHccHHHHHHccEEEEEccHHHHHHHHHHHHHHHHccccc //