[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57534.1
DDBJ      :             Conserved hypothetical protein 91
Swiss-Prot:TRMB_NITOC   RecName: Full=tRNA (guanine-N(7)-)-methyltransferase;         EC=2.1.1.33;AltName: Full=tRNA(m7G46)-methyltransferase;

Homologs  Archaea  0/68 : Bacteria  737/915 : Eukaryota  36/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:236 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->232 3dxyA PDBj 2e-53 49.7 %
:RPS:PDB   34->232 3dxxA PDBj 3e-44 49.2 %
:RPS:SCOP  55->231 1yzhA1  c.66.1.53 * 4e-18 23.9 %
:HMM:SCOP  11->232 1zx0A1 c.66.1.16 * 6.6e-37 32.4 %
:RPS:PFM   48->233 PF02390 * Methyltransf_4 2e-45 47.8 %
:HMM:PFM   53->232 PF02390 * Methyltransf_4 2.7e-58 37.2 180/197  
:BLT:SWISS 1->236 TRMB_NITOC e-140 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57534.1 GT:GENE ABA57534.1 GT:PRODUCT Conserved hypothetical protein 91 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1136747..1137457) GB:FROM 1136747 GB:TO 1137457 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein 91 GB:PROTEIN_ID ABA57534.1 GB:DB_XREF GI:76882853 InterPro:IPR000051 InterPro:IPR003358 InterPro:IPR004395 LENGTH 236 SQ:AASEQ MSNSITLEERGESFQPRPITSFVRREGRMTPAQKKALEHLWPRYGIDLGTGPLNLAAIFNRQAERILEIGFGNGESLLQQARAAPERDFLGIEVYRPGIGHLLLRLKAEGLENIRVIHGDAWEVLQRALPNPSLDGVQIFFPDPWPKKRHHKRRLIQPSFVDLLERKIKPGGWFHLATDWQDYAEQIKAVLSQHAGFNQLTNEGQSTQRPRTKFEARGQQQGHGVWDLRFKRSVDS GT:EXON 1|1-236:0| SW:ID TRMB_NITOC SW:DE RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; EC=2.1.1.33;AltName: Full=tRNA(m7G46)-methyltransferase; SW:GN Name=trmB; OrderedLocusNames=Noc_1026; SW:KW Complete proteome; Methyltransferase; S-adenosyl-L-methionine;Transferase; tRNA processing. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->236|TRMB_NITOC|e-140|100.0|236/236| GO:SWS:NREP 3 GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| BL:PDB:NREP 1 BL:PDB:REP 36->232|3dxyA|2e-53|49.7|197/207| RP:PDB:NREP 1 RP:PDB:REP 34->232|3dxxA|3e-44|49.2|199/208| RP:PFM:NREP 1 RP:PFM:REP 48->233|PF02390|2e-45|47.8|186/197|Methyltransf_4| HM:PFM:NREP 1 HM:PFM:REP 53->232|PF02390|2.7e-58|37.2|180/197|Methyltransf_4| GO:PFM:NREP 2 GO:PFM GO:0006400|"GO:tRNA modification"|PF02390|IPR003358| GO:PFM GO:0008176|"GO:tRNA (guanine-N7-)-methyltransferase activity"|PF02390|IPR003358| RP:SCP:NREP 1 RP:SCP:REP 55->231|1yzhA1|4e-18|23.9|176/204|c.66.1.53| HM:SCP:REP 11->232|1zx0A1|6.6e-37|32.4|210/0|c.66.1.16|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 783 OP:NHOMOORG 773 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-11111111111111111111----1-111--1111111--1-11111111-1111111----11---------------1---11----1111111111111111---11---1-1----------11111111111-11111111-1111111-11111--11111111-11111111111111111111111111111111111111111-1111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111--1----------------1---11----11--11----1-------1---11111111111111111111111111111111111-11111111111-1111111111111111111111111111111111111111111--------11--1111-111111111-11-1111111111111111111111111111111111111111111111111111111111111111111111111111---------------11111111111-111--11-111111111111111111111111111111111111111111111111111111--1111111-11111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--12---1-1111111111111-1111111111111111111111111111111111111111---11-1-111111111111111111111111111111111111111--------111----1-11-1111--11---111111111111111111 ----1--------1-------------------------------------------1----1---1----1---11111--------------1-----------113-------------------------------------------------1---11-----------11--71111-1111-1--121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 214 STR:RPRED 90.7 SQ:SECSTR ###################HHTcccccHHHHHHccHHHHHHHHHccccccccccHHHHHcccccEEEEEccTTcHHHHHHHHHcTTcEEEEEcccHHHHHHHHHHHHHTTcccEEEEcccHHHHHHHHccTTcEEEEEEEcccccccGGGGGGccccHHHHHHHHHHEEEEEEEEEEEccHHHHHHHHHHHHTcTTEEEccTTcccTTccccTTccTTcTTccccEEEEEEEc### DISOP:02AL 1-4, 8-13, 235-236| PSIPRED cccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccHHHHccccccEEEEEEcccHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHcccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHcccEEEEEEEEcccc //