[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57543.1
DDBJ      :             Protein of unknown function DUF190
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.5
:104 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->100 2dclC PDBj 1e-06 32.6 %
:RPS:PDB   1->100 2dclC PDBj 1e-09 28.9 %
:RPS:SCOP  9->90 1o51A  d.58.5.4 * 7e-08 39.7 %
:HMM:SCOP  4->101 1o51A_ d.58.5.4 * 1.4e-20 38.1 %
:RPS:PFM   8->92 PF02641 * DUF190 4e-10 40.2 %
:HMM:PFM   8->94 PF02641 * DUF190 3.2e-15 37.2 86/101  
:BLT:SWISS 8->86 Y021_THEMA 5e-09 37.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57543.1 GT:GENE ABA57543.1 GT:PRODUCT Protein of unknown function DUF190 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1144779..1145093 GB:FROM 1144779 GB:TO 1145093 GB:DIRECTION + GB:PRODUCT Protein of unknown function DUF190 GB:PROTEIN_ID ABA57543.1 GB:DB_XREF GI:76882862 InterPro:IPR003793 LENGTH 104 SQ:AASEQ MRTKDVMMVRIYLTEAEGHLDTLLKRLHDWSQVQGVTVFHGIAGFGPSGPMHPISPARISGDLPVVVEFFDEPAKAEVILETLSHIIKPGHVVCWPARIIVEDK GT:EXON 1|1-104:0| BL:SWS:NREP 1 BL:SWS:REP 8->86|Y021_THEMA|5e-09|37.2|78/102| BL:PDB:NREP 1 BL:PDB:REP 5->100|2dclC|1e-06|32.6|86/97| RP:PDB:NREP 1 RP:PDB:REP 1->100|2dclC|1e-09|28.9|90/97| RP:PFM:NREP 1 RP:PFM:REP 8->92|PF02641|4e-10|40.2|82/101|DUF190| HM:PFM:NREP 1 HM:PFM:REP 8->94|PF02641|3.2e-15|37.2|86/101|DUF190| RP:SCP:NREP 1 RP:SCP:REP 9->90|1o51A|7e-08|39.7|68/89|d.58.5.4| HM:SCP:REP 4->101|1o51A_|1.4e-20|38.1|97/0|d.58.5.4|1/1|GlnB-like| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------1-----------1-------------------------------------------11---------------------------------1--1---------------------------------------------------------------------------------------------111-1----1------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 92 STR:RPRED 88.5 SQ:SECSTR cccccEEEEEEEEETTcEEHHHHHHHHHHTHTccccEEEEcccccccc########cccTTccEEEEEEEEEHHHHHHHHHHHGGGccccEEEEEEEccc#### DISOP:02AL 1-3| PSIPRED cccccEEEEEEEEccccccHHHHHHHHHHHcccccccEEEEEccccccccccccccEEEcccccEEEEEEccHHHHHHHHHHHHHHccccEEEEEEEEEEEEcc //