[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57552.1
DDBJ      :             HesB/YadR/YfhF
Swiss-Prot:ERPA_NITOC   RecName: Full=Iron-sulfur cluster insertion protein erpA;

Homologs  Archaea  10/68 : Bacteria  611/915 : Eukaryota  177/199 : Viruses  0/175   --->[See Alignment]
b.124.1
:116 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->115 2apnA PDBj 7e-41 66.1 %
:RPS:PDB   3->115 2apnA PDBj 4e-38 63.7 %
:RPS:SCOP  5->102 1nwbA  b.124.1.1 * 4e-29 40.8 %
:HMM:SCOP  2->102 1nwbA_ b.124.1.1 * 1e-29 41.6 %
:RPS:PFM   11->102 PF01521 * Fe-S_biosyn 1e-20 46.7 %
:HMM:PFM   13->102 PF01521 * Fe-S_biosyn 1.1e-29 43.8 89/91  
:BLT:SWISS 1->116 ERPA_NITOC 3e-66 100.0 %
:PROS 97->114|PS01152|HESB

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57552.1 GT:GENE ABA57552.1 GT:PRODUCT HesB/YadR/YfhF GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1152092..1152442) GB:FROM 1152092 GB:TO 1152442 GB:DIRECTION - GB:PRODUCT HesB/YadR/YfhF GB:PROTEIN_ID ABA57552.1 GB:DB_XREF GI:76882871 InterPro:IPR000361 LENGTH 116 SQ:AASEQ MNVTNAMPNPLIFTDIAAGKVKELIEEEGNDKLMLRVFITGGGCSGFQYGFTFDETSHEGDTRVKNGGVTLLIDPTSYQYLVGAEIDYTEGLEGAQFVIRNPNAETTCGCGSSFSP GT:EXON 1|1-116:0| SW:ID ERPA_NITOC SW:DE RecName: Full=Iron-sulfur cluster insertion protein erpA; SW:GN Name=erpA; OrderedLocusNames=Noc_1044; SW:KW Complete proteome; Iron; Iron-sulfur; Metal-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->116|ERPA_NITOC|3e-66|100.0|116/116| GO:SWS:NREP 2 GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 97->114|PS01152|HESB|PDOC00887| BL:PDB:NREP 1 BL:PDB:REP 7->115|2apnA|7e-41|66.1|109/114| RP:PDB:NREP 1 RP:PDB:REP 3->115|2apnA|4e-38|63.7|113/114| RP:PFM:NREP 1 RP:PFM:REP 11->102|PF01521|1e-20|46.7|92/92|Fe-S_biosyn| HM:PFM:NREP 1 HM:PFM:REP 13->102|PF01521|1.1e-29|43.8|89/91|Fe-S_biosyn| RP:SCP:NREP 1 RP:SCP:REP 5->102|1nwbA|4e-29|40.8|98/101|b.124.1.1| HM:SCP:REP 2->102|1nwbA_|1e-29|41.6|101/101|b.124.1.1|1/1|HesB-like domain| OP:NHOMO 1303 OP:NHOMOORG 798 OP:PATTERN ------------------------1--11-11------------------111-------------11 1211111111111111111-111111111111111111111122111111111111111111111111111-----------112111-----------1-111111112--------------1---------2-11111---112333332111111111-2212433311111111111111111---1111111111111111111-11111111111-11------211--------------11111--------------------------------------------------------------------------------------------------1----11---------------1-1222211111332332223333322222222222-2232232223221222333222223222222233332222222222212212223-1111111112222222222222221111222223222221112111111111121111111331211221113111123121222322222222222222222331-----------------------111122---------------------------332221111122121111222222222112221--222211111111212211111111111-111111111111111111122222222111111111111111121111111212111111111111112111111111322222222222222222222222222222312222222122222222211111111122222222222222211122221211111213-----------------------------------------------------42- 1---221-1---2222122-211211122221-12111112-121211122222-11-1111222111-1212221111112212122--21111111112-1333-2223322321-2222223212-362-2232211212222221121-2133232122211-224513222332S2223365561433232221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 114 STR:RPRED 98.3 SQ:SECSTR #ccccccccccEEccHHHHHHHHHHHHHTccccEEEEcccccccccccccEEEccccccccEEEEccccEEEEcHHHHHHHTTcEEEEEccccccEEEEEcHHHHcccccccccc# DISOP:02AL 1-6| PSIPRED ccccccccccEEEcHHHHHHHHHHHHccccccEEEEEEEEccccccEEEEEEEccccccccEEEEEccEEEEEcHHHHHHHcccEEEEEEccccccEEEEcccccccccccccccc //