[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57565.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->54 PF01490 * Aa_trans 0.00064 22.2 45/409  
:BLT:SWISS 86->127 NUSB_CHLT3 4e-04 50.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57565.1 GT:GENE ABA57565.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1163559..1164020) GB:FROM 1163559 GB:TO 1164020 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57565.1 GB:DB_XREF GI:76882884 LENGTH 153 SQ:AASEQ MTNKEDSNFTQNLKNPAFWKRFLFMMLFAVAYTLAEFAVWAAVIFLIFYNLITGGSNERAVTFGRQVSAYIYHLLLYLTYNTEERPFPFTDWPRPENMPTGLGYPLTPNAGEATTGRNPSPQPPNPTTGAAQSVPETTAANPAFRKEGSSQTE GT:EXON 1|1-153:0| BL:SWS:NREP 1 BL:SWS:REP 86->127|NUSB_CHLT3|4e-04|50.0|40/211| TM:NTM 1 TM:REGION 25->47| HM:PFM:NREP 1 HM:PFM:REP 10->54|PF01490|0.00064|22.2|45/409|Aa_trans| OP:NHOMO 14 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------2----1----------------------1---------------------------------------------------------------------------------------------------------1------------------------------11111-1-1---------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 107-153| PSIPRED ccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //