[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57569.1
DDBJ      :             transcriptional regulatory protein, Crp family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  560/915 : Eukaryota  60/199 : Viruses  0/175   --->[See Alignment]
a.4.5b.82.3
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->206 1hw5B PDBj 2e-29 39.7 %
:RPS:PDB   14->206 1db9A PDBj 4e-34 36.8 %
:RPS:SCOP  11->140 2h6bA2  b.82.3.2 * 3e-25 18.9 %
:RPS:SCOP  143->210 2gauA1  a.4.5.4 * 2e-07 22.1 %
:HMM:SCOP  12->140 1omiA1 b.82.3.3 * 2.8e-32 38.8 %
:HMM:SCOP  142->209 1hw5A1 a.4.5.4 * 1.6e-13 39.7 %
:RPS:PFM   25->112 PF00027 * cNMP_binding 2e-17 47.7 %
:HMM:PFM   26->115 PF00027 * cNMP_binding 8.1e-29 48.9 90/91  
:HMM:PFM   169->194 PF00325 * Crp 1.5e-11 46.2 26/32  
:HMM:PFM   103->170 PF09771 * Tmemb_18A 0.00055 27.9 68/126  
:BLT:SWISS 28->206 CRP_SHIFL 2e-28 39.1 %
:PROS 75->92|PS00889|CNMP_BINDING_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57569.1 GT:GENE ABA57569.1 GT:PRODUCT transcriptional regulatory protein, Crp family GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1166070..1166714) GB:FROM 1166070 GB:TO 1166714 GB:DIRECTION - GB:PRODUCT transcriptional regulatory protein, Crp family GB:PROTEIN_ID ABA57569.1 GB:DB_XREF GI:76882888 InterPro:IPR000595 InterPro:IPR001808 InterPro:IPR002373 LENGTH 214 SQ:AASEQ MPLNILSPIAFSPEDLELLRGCGVTRTYPKYTILIHEGDLSDSLYIILSGKVKVYISDEGGKEVILRTQKAGEYFGELALLDKGPRSASVMTLDKSRLSVVSKTIFNRCLTEHPDFALKLLCALTQRVRSLTENVKNLALLDVYGRVARTLLDLAIEKGGKLIIEERPTHQEIAQRVGASREMVSRIMGDLATGGYIEVTSKTIIIPHRLPSAW GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 28->206|CRP_SHIFL|2e-28|39.1|179/210| PROS 75->92|PS00889|CNMP_BINDING_2|PDOC00691| BL:PDB:NREP 1 BL:PDB:REP 28->206|1hw5B|2e-29|39.7|179/205| RP:PDB:NREP 1 RP:PDB:REP 14->206|1db9A|4e-34|36.8|193/200| RP:PFM:NREP 1 RP:PFM:REP 25->112|PF00027|2e-17|47.7|88/90|cNMP_binding| HM:PFM:NREP 3 HM:PFM:REP 26->115|PF00027|8.1e-29|48.9|90/91|cNMP_binding| HM:PFM:REP 169->194|PF00325|1.5e-11|46.2|26/32|Crp| HM:PFM:REP 103->170|PF09771|0.00055|27.9|68/126|Tmemb_18A| RP:SCP:NREP 2 RP:SCP:REP 11->140|2h6bA2|3e-25|18.9|127/145|b.82.3.2| RP:SCP:REP 143->210|2gauA1|2e-07|22.1|68/81|a.4.5.4| HM:SCP:REP 12->140|1omiA1|2.8e-32|38.8|129/0|b.82.3.3|1/1|cAMP-binding domain-like| HM:SCP:REP 142->209|1hw5A1|1.6e-13|39.7|68/71|a.4.5.4|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 1037 OP:NHOMOORG 620 OP:PATTERN -------------------------------------------------------------------- 156-311111111122211-12111211111111111111132411122---111111--534151131211111111----411212-----111-----1121312-2----------------1-------3-344321-12-734522211331111--34316545-1-----1----3321111--21111111-11111111-122-1111-331-12------311----------------------111121----1111-1111-----------------------------------------------1-231344434332411----333-21-11--238944113111112----12--113------44561313132522212222222-22223425--2-11111121-13211--2--11211322--------1----631-------------------------------131------2--21213232111-3333231-13332--33132--121223-1-31-1121-------1--43465221211143112-41322222311-16533-1-1--------1--------1-1211111-111-1-111111111111111111111--21-1------21111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--12----------12--1111111111111112222211---2222221213111112111----------1111111111111111111111111111--1-445566--------2-2--------------------------2-1-------2- ------------111222211121111111111111111211-11122--22121-111111---------------------------1--2---1------11------2-------------------------------------------1-------22---121------------------2----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 210 STR:RPRED 98.1 SQ:SECSTR ####cHHHHcccHcHHHHHHTTcEEEEEcTTcEEEcTTccccEEEEEEEccEEEEEEcTTccEEEEEEEcTTcEEccTTTTcccccccEEEEcccEEEEEEEHHHHHHHHHHcTHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHTcEEETTEEEEEccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEETTEEEEcTTccccc DISOP:02AL 214-215| PSIPRED ccHHHHccccccHHHHHHHHHccEEEEEccccEEEcccccccEEEEEEEEEEEEEEEcccccEEEEEEEccccEEEEHHHHccccEEEEEEEEccEEEEEEEHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccEEEEcccHHHcc //