[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57574.1
DDBJ      :             Rhomboid-like protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  109/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.51.1
:225 amino acids
:PSIPRED
:RPS:SCOP  11->131 2ic8A1  f.51.1.1 * 9e-09 22.2 %
:HMM:SCOP  11->220 2ic8A1 f.51.1.1 * 5.7e-38 42.8 %
:RPS:PFM   71->161 PF01694 * Rhomboid 9e-07 34.1 %
:HMM:PFM   69->218 PF01694 * Rhomboid 7.6e-36 41.8 134/146  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57574.1 GT:GENE ABA57574.1 GT:PRODUCT Rhomboid-like protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1174592..1175269) GB:FROM 1174592 GB:TO 1175269 GB:DIRECTION - GB:PRODUCT Rhomboid-like protein GB:PROTEIN_ID ABA57574.1 GB:DB_XREF GI:76882893 InterPro:IPR002610 LENGTH 225 SQ:AASEQ MIPISDNYPVQRTPIVNWILIGTCVLVFLWQLSLPQEGFQASVILFGLIPKALTDAPLGHPQLLIPPVLSLFTSMFLHGGFLHLLGNMLYLHVFGNNVEDSMGHGRFIVFYLLCGVAAALAQTFIAPDSTIPMVGASGAISGILGAYLLLHPFAQIKLLVPYFILFFVWVPAWLMLGLWFLFQLLQSAATPGDEGGIAFAAHAGGFMAGMLLLPVFKRSDVSLLR GT:EXON 1|1-225:0| TM:NTM 4 TM:REGION 13->35| TM:REGION 103->125| TM:REGION 131->153| TM:REGION 163->185| SEG 76->86|flhggflhllg| SEG 135->146|gasgaisgilga| SEG 173->186|wlmlglwflfqllq| SEG 195->210|ggiafaahaggfmagm| RP:PFM:NREP 1 RP:PFM:REP 71->161|PF01694|9e-07|34.1|91/146|Rhomboid| HM:PFM:NREP 1 HM:PFM:REP 69->218|PF01694|7.6e-36|41.8|134/146|Rhomboid| GO:PFM:NREP 2 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF01694|IPR002610| GO:PFM GO:0016021|"GO:integral to membrane"|PF01694|IPR002610| RP:SCP:NREP 1 RP:SCP:REP 11->131|2ic8A1|9e-09|22.2|108/182|f.51.1.1| HM:SCP:REP 11->220|2ic8A1|5.7e-38|42.8|180/0|f.51.1.1|1/1|Rhomboid-like| OP:NHOMO 126 OP:NHOMOORG 115 OP:PATTERN ------------------11111-----------------------------------------1--- -11-1-----------------------------------111------------------------11-1------------1-111------------------------------------------------11111---112121---11-----------1333------------------11-------------------------------------------------------------------------------------------------------------------------------------1---------------------------1---1--1111-11-111----111-------------1----------------------------111--11---1--111-1---1111111111--------------11-----------------------------------------------------------------------------------------------------------111-111-11111-----11-111121111---------------------------------1-----1--11----------1------2---------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------11-11111111-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccHHHHHHccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccc //