[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57587.1
DDBJ      :             Protein of unknown function DUF785
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  104/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.50.1
:181 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->145 2pmaB PDBj 2e-12 41.0 %
:RPS:SCOP  28->163 2pmaA1  b.50.1.3 * 4e-11 33.6 %
:RPS:PFM   28->164 PF05618 * DUF785 9e-30 43.4 %
:HMM:PFM   28->161 PF05618 * DUF785 7e-41 40.6 133/138  
:BLT:SWISS 44->164 RIMK_SHEPA 7e-17 35.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57587.1 GT:GENE ABA57587.1 GT:PRODUCT Protein of unknown function DUF785 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1187053..1187598 GB:FROM 1187053 GB:TO 1187598 GB:DIRECTION + GB:PRODUCT Protein of unknown function DUF785 GB:PROTEIN_ID ABA57587.1 GB:DB_XREF GI:76882906 InterPro:IPR008503 LENGTH 181 SQ:AASEQ MISWLFLGGLAEAGEPGNGKEGTNERVIMGWVEPVVLIPWGVELKAKLDSGAKTSSLHAEDIERFKKDGEEWVRFVIDIERKAKKIKQLHVEQPLARDVHIKRHRGSAKKRPVVSLEFCLNGKRHKAQFSLVDRSQLNYPVLLGRRFLKKAALIDSGKIFLTREGWKTCLVEYAAGEAPKS GT:EXON 1|1-181:0| BL:SWS:NREP 1 BL:SWS:REP 44->164|RIMK_SHEPA|7e-17|35.0|120/458| BL:PDB:NREP 1 BL:PDB:REP 28->145|2pmaB|2e-12|41.0|105/127| RP:PFM:NREP 1 RP:PFM:REP 28->164|PF05618|9e-30|43.4|136/137|DUF785| HM:PFM:NREP 1 HM:PFM:REP 28->161|PF05618|7e-41|40.6|133/138|DUF785| RP:SCP:NREP 1 RP:SCP:REP 28->163|2pmaA1|4e-11|33.6|125/126|b.50.1.3| OP:NHOMO 209 OP:NHOMOORG 105 OP:PATTERN -------------------------------------------------1------------------ --------------------------------------------------------1--------------------------------------------11-1--1---------------------------------------11-111----1-----1------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------11------1------------------------------------------------1---------------------------------------------------------------------11------1-2-----2-----------1-----------------------------1------222122-111111111332111-2-32-32---2222--------------------------------------------------------------------------------------------111-11111113-21-------------------------3244443333343334333---------253433333344433------------------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 114 STR:RPRED 63.0 SQ:SECSTR ###########################EEccEEEEEEGGGTEEEEEEEcTTcccEEEEcEEEEEEEETTEEEEEEEEEETTEEETTEEEEEEEEccccccc####EEEEcccEEEEEEEETTEEEEEEEEEEccccccccEEEcH#################################### DISOP:02AL 17-21, 102-106, 178-181| PSIPRED cEEEEEEHHHHHHcccccccccccccEEEEEEEEEEEcccccEEEEEEccccEEEEEEcEEcEEEEccccEEEEEEEEEcccccccEEEEEEEEEEEEEEEEEccccccccEEEEEEEEEccEEEEEEEEEEccccccEEEEEEcHHHHccEEEcccccEEEccccccEEEEEEccccccc //