[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57591.1
DDBJ      :             Peptidylprolyl isomerase, FKBP-type
Swiss-Prot:             

Homologs  Archaea  39/68 : Bacteria  400/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
d.26.1
:161 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->140 2kfwA PDBj 2e-34 45.7 %
:RPS:PDB   1->140 3cgnA PDBj 5e-31 47.4 %
:RPS:SCOP  3->140 1ix5A  d.26.1.1 * 2e-30 37.3 %
:HMM:SCOP  2->141 1ix5A_ d.26.1.1 * 2.2e-34 48.5 %
:RPS:PFM   9->71 PF00254 * FKBP_C 2e-11 52.4 %
:HMM:PFM   4->137 PF00254 * FKBP_C 2.7e-19 40.5 79/96  
:BLT:SWISS 1->140 SLYD_SHIFL 7e-34 45.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57591.1 GT:GENE ABA57591.1 GT:PRODUCT Peptidylprolyl isomerase, FKBP-type GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1191836..1192321) GB:FROM 1191836 GB:TO 1192321 GB:DIRECTION - GB:PRODUCT Peptidylprolyl isomerase, FKBP-type GB:PROTEIN_ID ABA57591.1 GB:DB_XREF GI:76882910 InterPro:IPR001179 LENGTH 161 SQ:AASEQ MQVADKKVVYIHYTLKNQEGAVLDSSSQKTPLAYIHGLGNIIPGLEKALAGKSEGDKLNVSIEPKDAYGERNETLLQTVPRDAFQDVEELEEGMQFQAQTPNGPQLITVAEIETDQVLVDANHPLAGETLDFDVEVVDVRNATEEELEHGHAHGAGGHQHA GT:EXON 1|1-161:0| BL:SWS:NREP 1 BL:SWS:REP 1->140|SLYD_SHIFL|7e-34|45.7|140/196| SEG 142->160|ateeelehghahgagghqh| BL:PDB:NREP 1 BL:PDB:REP 1->140|2kfwA|2e-34|45.7|140/196| RP:PDB:NREP 1 RP:PDB:REP 1->140|3cgnA|5e-31|47.4|135/151| RP:PFM:NREP 1 RP:PFM:REP 9->71|PF00254|2e-11|52.4|63/91|FKBP_C| HM:PFM:NREP 1 HM:PFM:REP 4->137|PF00254|2.7e-19|40.5|79/96|FKBP_C| GO:PFM:NREP 1 GO:PFM GO:0006457|"GO:protein folding"|PF00254|IPR001179| RP:SCP:NREP 1 RP:SCP:REP 3->140|1ix5A|2e-30|37.3|134/151|d.26.1.1| HM:SCP:REP 2->141|1ix5A_|2.2e-34|48.5|136/151|d.26.1.1|1/1|FKBP-like| OP:NHOMO 757 OP:NHOMOORG 451 OP:PATTERN -----1--111111---------11---31--1-1112111111123122322-1111221------1 ------------------------------------------------------------------------------1112---1111111-111-------1111211---------------111111111-1---11-----111-11-------------------------------11111--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------1------------------1---------------------------1-1----1-----------1--------111-------------2--------------------------------1----11111222222112221211222222221222222222223233333322223211211111111111222221221111-1111-212322232111121-3111111111111111111111111111221143323333333333333333333333---1213------22222222222222222-2222222222222222222222222222112222222222222222232222-222222222222--12---------134331111111111111112222222222232222222222222222211111111132222222222222211222221221111----111111--------11--------------------------11-11------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------------111D12111-----------11- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 87.0 SQ:SECSTR ccccTTEEEEEEEEEEETTTEEEEEEEEEcEEEEETTcccccHHHHHHHTTccTTcEEEEEEcGGGTTccccGGGEEEEcGGGccccccccTTcEEcccccccccccEEEEEETTEEEEEcccTTTTccEEEEEEEEEEE##################### DISOP:02AL 1-4, 152-161| PSIPRED cccccccEEEEEEEEEEccccEEEcccccccEEEEEccccccHHHHHHHHccccccEEEEEEcHHHHcccccccccEEEcHHHccccccccccEEEEEEcccccEEEEEEEEcccEEEEEccccccccEEEEEEEEEEEEcccHHHHHccccccccccccc //