[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57614.1
DDBJ      :             HicB-related protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  70/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.43.1
:110 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->78 2dsyD PDBj 3e-08 22.7 %
:HMM:SCOP  67->111 1mntA_ a.43.1.1 * 3.1e-08 31.1 %
:RPS:PFM   60->104 PF05534 * HicB 4e-06 48.9 %
:HMM:PFM   55->104 PF05534 * HicB 5.2e-25 52.0 50/51  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57614.1 GT:GENE ABA57614.1 GT:PRODUCT HicB-related protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1211858..1212190 GB:FROM 1211858 GB:TO 1212190 GB:DIRECTION + GB:PRODUCT HicB-related protein GB:PROTEIN_ID ABA57614.1 GB:DB_XREF GI:76882933 InterPro:IPR008651 LENGTH 110 SQ:AASEQ MNVLEVDGFKAKIEFDPDLDLFRGEILGLNGSADFYGKSPASLRKEFKNSLKVFLEVCEEKGIEPTKEFSGKFNLRIPPRLHSEISAKAAASNKSINQWVVEVLEESVNE GT:EXON 1|1-110:0| SEG 83->97|seisakaaasnksin| RP:PDB:NREP 1 RP:PDB:REP 1->78|2dsyD|3e-08|22.7|75/79| RP:PFM:NREP 1 RP:PFM:REP 60->104|PF05534|4e-06|48.9|45/47|HicB| HM:PFM:NREP 1 HM:PFM:REP 55->104|PF05534|5.2e-25|52.0|50/51|HicB| HM:SCP:REP 67->111|1mntA_|3.1e-08|31.1|45/0|a.43.1.1|1/1|Ribbon-helix-helix| OP:NHOMO 79 OP:NHOMOORG 70 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------1-----1----------------1----1---1------------11--11-----------1----1----------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1-----------1--1-11--------1-----11111111----1-------------------------------------------------1-------------------------1------------------------------1--------1--1-------131-----------1------------------------------------------------------------1-----------------11-----21-1--212-2121----------1---2------------------1--1111----------------1-------------------1-1------------------1-----1----1-12--------------------------------------1111------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 75 STR:RPRED 68.2 SQ:SECSTR HHHHHHHHHTcEEEEccccccEEEEcTTcTT#cEEEEccHHHHHHHHHHHHHHHHHHHHHTTccccc##cTTcccccc################################ DISOP:02AL 107-110| PSIPRED ccEEEEccEEEEEEEEccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcc //