[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57628.1
DDBJ      :             NADH dehydrogenase (ubiquinone),  24 kDa subunit
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  538/915 : Eukaryota  167/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:154 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   15->136 3iam2 PDBj 1e-18 36.1 %
:RPS:PDB   71->153 2auvA PDBj 2e-23 32.5 %
:RPS:SCOP  2->152 2fug21  c.47.1.21 * 1e-30 31.1 %
:HMM:SCOP  2->154 2fug21 c.47.1.21 * 1e-45 42.5 %
:RPS:PFM   15->150 PF01257 * Complex1_24kDa 1e-28 42.6 %
:HMM:PFM   12->153 PF01257 * Complex1_24kDa 3.1e-47 39.4 142/145  
:BLT:SWISS 1->153 NUOE_PSEAE 2e-43 48.4 %
:PROS 111->129|PS01099|COMPLEX1_24K
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57628.1 GT:GENE ABA57628.1 GT:PRODUCT NADH dehydrogenase (ubiquinone), 24 kDa subunit GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1226988..1227452) GB:FROM 1226988 GB:TO 1227452 GB:DIRECTION - GB:PRODUCT NADH dehydrogenase (ubiquinone), 24 kDa subunit GB:PROTEIN_ID ABA57628.1 GB:DB_XREF GI:76882947 InterPro:IPR002023 LENGTH 154 SQ:AASEQ MLSTEEIKAIDAERAHYPTAQAVGIEAMKIVQHHRGWVSDESLREIAEYLGLSVESLDGAATFYNLIFRRPVGKHVILICDSVSCWIMGYEQLREQLQTELKIGLGETTQDGRFTLLPSCCLGACERAPVMVVDQDLHGDLDSEKIGEILAGYE GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 1->153|NUOE_PSEAE|2e-43|48.4|153/166| PROS 111->129|PS01099|COMPLEX1_24K|PDOC00843| TM:NTM 1 TM:REGION 71->93| BL:PDB:NREP 1 BL:PDB:REP 15->136|3iam2|1e-18|36.1|122/179| RP:PDB:NREP 1 RP:PDB:REP 71->153|2auvA|2e-23|32.5|83/85| RP:PFM:NREP 1 RP:PFM:REP 15->150|PF01257|1e-28|42.6|136/142|Complex1_24kDa| HM:PFM:NREP 1 HM:PFM:REP 12->153|PF01257|3.1e-47|39.4|142/145|Complex1_24kDa| GO:PFM:NREP 3 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01257|IPR002023| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF01257|IPR002023| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01257|IPR002023| RP:SCP:NREP 1 RP:SCP:REP 2->152|2fug21|1e-30|31.1|151/178|c.47.1.21| HM:SCP:REP 2->154|2fug21|1e-45|42.5|153/0|c.47.1.21|1/1|Thioredoxin-like| OP:NHOMO 962 OP:NHOMOORG 711 OP:PATTERN -----------------------------1----1---------1--1----------1-1------- 11211---------11111-11--12111111211111111111-1--1-----------11111111111----------1-11112--1--1-----1-11--21111--------------1-----1---1-22222444111111111--11------11--11--------------11111331--------------------------------------------------------------1---------------------------------------------------------------------144-1111111111121------2-2112--23113436331211121--3--111111111232221123333311111111111-22222222121122223332223322111122333311111111111322-21111111111111111111111111111111111121-22212111111111111111111111112223311111321111112222221222111111111112122131-2-1--3-----343243265111111641--1---------------------11112---2-----------------1----11--211111111111111111111111111-1111111111111111111111111111111111111111111111111111-1111111-1-1111111111111113--11---------------11111111111-1111221122222-1111111111111--------------11111111111111111-111111------------------------------------322333323322- ----111-211-11111111111111-1111111111111-1111111111111111111-1111----1--111------11111---12111111111111112-111211111111111111113-3A1-3121--11113111--11111-11111111111221251111111171111121321111121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 139 STR:RPRED 90.3 SQ:SECSTR ##############TTccTTGGGHHHHHHHHHHHHccccHHHHHHHHHHHTccHHHHHHHHTTcccccccccccccEEccccHHHHTTTHHHHHHHHHHHHccccccccccccccccccccccccTTccccEEGGGccccccccHHHHHHHHc# PSIPRED cccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccEEEEEEccHHHHHccHHHHHHHHHHHHcccccccccccEEEEEEEEEccccccccEEEEccEEEccccHHHHHHHHHHcc //