[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57632.1
DDBJ      :             Protocatechuate 3 4-dioxygenase beta subunit like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  78/915 : Eukaryota  48/199 : Viruses  0/175   --->[See Alignment]
b.3.6
:252 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   77->199 2butB PDBj 5e-07 36.8 %
:RPS:PDB   30->250 2bumB PDBj 2e-26 28.3 %
:RPS:SCOP  58->250 1s9aA  b.3.6.1 * 1e-25 28.4 %
:HMM:SCOP  43->252 1s9aA_ b.3.6.1 * 4.6e-39 36.3 %
:RPS:PFM   63->193 PF00775 * Dioxygenase_C 7e-15 45.3 %
:HMM:PFM   62->193 PF00775 * Dioxygenase_C 3.8e-17 38.3 120/183  
:HMM:PFM   7->27 PF10518 * TAT_signal 0.00039 38.1 21/26  
:BLT:SWISS 62->193 CATA_RHOOP 2e-07 36.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57632.1 GT:GENE ABA57632.1 GT:PRODUCT Protocatechuate 3 4-dioxygenase beta subunit like protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1231197..1231955 GB:FROM 1231197 GB:TO 1231955 GB:DIRECTION + GB:PRODUCT Protocatechuate 3 4-dioxygenase beta subunit like protein GB:PROTEIN_ID ABA57632.1 GB:DB_XREF GI:76882951 InterPro:IPR000627 InterPro:IPR006311 LENGTH 252 SQ:AASEQ MKITGCNLSRRRMLLLTGVTAASLVMGKRVSGQSMPRTPTQTPLKRAMVVMPSCVVRPQQTEGPYFVDEKLNRSDIRFEPSDHSMKKGVPLRLVFRVSQLEGNVCTPLKGAIVDVWQCDALGVYSGFQDINGLFDTRGKKFLRGYQITDAIGKAEFVTIYPGWYPGRTVHIHFKIRTDSASPQGHEFTSQLYFHDSITDRVHAQAPYATKGRRNSSNEDDRIFQRGGSELILPLARETAGYVGTFDIGLQMT GT:EXON 1|1-252:0| BL:SWS:NREP 1 BL:SWS:REP 62->193|CATA_RHOOP|2e-07|36.1|119/270| BL:PDB:NREP 1 BL:PDB:REP 77->199|2butB|5e-07|36.8|117/238| RP:PDB:NREP 1 RP:PDB:REP 30->250|2bumB|2e-26|28.3|191/238| RP:PFM:NREP 1 RP:PFM:REP 63->193|PF00775|7e-15|45.3|117/153|Dioxygenase_C| HM:PFM:NREP 2 HM:PFM:REP 62->193|PF00775|3.8e-17|38.3|120/183|Dioxygenase_C| HM:PFM:REP 7->27|PF10518|0.00039|38.1|21/26|TAT_signal| GO:PFM:NREP 4 GO:PFM GO:0003824|"GO:catalytic activity"|PF00775|IPR000627| GO:PFM GO:0006725|"GO:cellular aromatic compound metabolic process"|PF00775|IPR000627| GO:PFM GO:0008199|"GO:ferric iron binding"|PF00775|IPR000627| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00775|IPR000627| RP:SCP:NREP 1 RP:SCP:REP 58->250|1s9aA|1e-25|28.4|162/256|b.3.6.1| HM:SCP:REP 43->252|1s9aA_|4.6e-39|36.3|179/0|b.3.6.1|1/1|Aromatic compound dioxygenase| OP:NHOMO 224 OP:NHOMOORG 126 OP:PATTERN -------------------------------------------------------------------- --------111-------------------------1112--1211---1--111-1-------2-2511-------------------------------1---1-1----------------------------11111---2-1-1----------------------------------21-11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------------11--------------------1-------1-------11111111--------------------------------------------------------------1--------------------------------1111-----1----1--------1--1-----------1--------------------------------2--------------------------------------------------------------2--------------------------------------------------111----------------------------11111111111--------------------------------------------1------1----------------------------------------------------------------------------------------------------------- ---------------1-22633-A98311-111-----------112211334312232111--1----------------------------2511-1-122------1-------------------------------------------------------------------------------1----42EA- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 219 STR:RPRED 86.9 SQ:SECSTR #############################TcGGGGccccccccc##cccccccccccHHHHccccccGGGccTTTccTcTTTTTcccccEEEEEEEEEETTccTcccccccEEEEEcccTTcccccTTccccccccccTTccEEEEEccTTcEEEEEEEccccEEEEccEEEEEEEcccGGGccccEEEEEEETTcGGcTTGGGcccHHHHHTTEEEEcGGGccHcHGGGEEEEEETTTcEEEEccEEEc## DISOP:02AL 1-6| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHcccccccHHHHccccccccccHHHEEccEEEcccccccccccccccccccccEEEEEEEEEEEccccccccccccEEEEEEEccccccccccccccccccccccccEEEEEEccccEEEEEEEEEccccccccEEEEEEEEccccccccEEEEEEEcccccccHHHHcccHHHccEEEEEcccccHHHcccccEEEEEccccccEEEEEEEEEEcc //