[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57641.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   5->83 3e0dA PDBj 4e-04 16.5 %
:HMM:PFM   70->116 PF01203 * GSPII_N 0.00088 23.4 47/252  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57641.1 GT:GENE ABA57641.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1244199..1244555) GB:FROM 1244199 GB:TO 1244555 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57641.1 GB:DB_XREF GI:76882960 LENGTH 118 SQ:AASEQ MPAGGPFADMLKFRGNKEISDQINTTISRLAEKRGKKTKETLDLVIYKKKYKTDLIPPILIIAHYFVRERTAIGAQIIAEMKRVTQGARWSGQGAGKALRRVAAATHPGSHYPLGTGG GT:EXON 1|1-118:0| RP:PDB:NREP 1 RP:PDB:REP 5->83|3e0dA|4e-04|16.5|79/1148| HM:PFM:NREP 1 HM:PFM:REP 70->116|PF01203|0.00088|23.4|47/252|GSPII_N| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 66.9 SQ:SECSTR ####TGGGHHHHHHHHHTTccccccTTcTTTHHHHHHHGGGTTccccHHHHHHHHHHHccccHHHHHHHHHHHHHTcTTTHHH################################### DISOP:02AL 1-4, 116-118| PSIPRED cccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccc //