[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57645.1
DDBJ      :             bacterial translation initiation factor 3 (bIF-3)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  883/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
d.15.8d.68.1
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->46 1tifA PDBj 8e-11 54.3 %
:BLT:PDB   70->152 1ife- PDBj 4e-32 71.1 %
:RPS:PDB   70->150 2crqA PDBj 8e-20 14.8 %
:RPS:SCOP  1->52 1tifA  d.15.8.1 * 3e-18 53.8 %
:RPS:SCOP  70->152 1tigA  d.68.1.1 * 2e-31 45.8 %
:HMM:SCOP  1->61 1tifA_ d.15.8.1 * 2.5e-21 65.6 %
:HMM:SCOP  65->154 2ifeA_ d.68.1.1 * 5.2e-33 57.8 %
:RPS:PFM   1->52 PF05198 * IF3_N 2e-14 67.3 %
:RPS:PFM   70->150 PF00707 * IF3_C 3e-20 60.5 %
:HMM:PFM   65->152 PF00707 * IF3_C 4.4e-37 56.8 88/88  
:HMM:PFM   2->60 PF05198 * IF3_N 8.5e-27 61.0 59/76  
:BLT:SWISS 1->152 IF3_AZOVI 3e-57 79.6 %
:PROS 41->54|PS00938|IF3
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57645.1 GT:GENE ABA57645.1 GT:PRODUCT bacterial translation initiation factor 3 (bIF-3) GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1250280..1250738 GB:FROM 1250280 GB:TO 1250738 GB:DIRECTION + GB:PRODUCT bacterial translation initiation factor 3 (bIF-3) GB:PROTEIN_ID ABA57645.1 GB:DB_XREF GI:76882964 InterPro:IPR001288 LENGTH 152 SQ:AASEQ MIGVDGEQIGVVSIEEALHVADEAGEDLVEIAPQAEPPVCRIMDYGKYLFEENKKRQAAKKKQKQIQIKEVKFRPGTEEGDYQVKLRNLVRFLTEGDKTKVSLRFRGRELAHQELGLKLLERVRNDLEEYGVVEQHPKREGRQMVMVLAPKK GT:EXON 1|1-152:0| BL:SWS:NREP 1 BL:SWS:REP 1->152|IF3_AZOVI|3e-57|79.6|152/181| PROS 41->54|PS00938|IF3|PDOC00723| SEG 54->69|kkrqaakkkqkqiqik| BL:PDB:NREP 2 BL:PDB:REP 1->46|1tifA|8e-11|54.3|46/76| BL:PDB:REP 70->152|1ife-|4e-32|71.1|83/91| RP:PDB:NREP 1 RP:PDB:REP 70->150|2crqA|8e-20|14.8|81/112| RP:PFM:NREP 2 RP:PFM:REP 1->52|PF05198|2e-14|67.3|52/74|IF3_N| RP:PFM:REP 70->150|PF00707|3e-20|60.5|81/87|IF3_C| HM:PFM:NREP 2 HM:PFM:REP 65->152|PF00707|4.4e-37|56.8|88/88|IF3_C| HM:PFM:REP 2->60|PF05198|8.5e-27|61.0|59/76|IF3_N| GO:PFM:NREP 4 GO:PFM GO:0003743|"GO:translation initiation factor activity"|PF05198|IPR019814| GO:PFM GO:0006413|"GO:translational initiation"|PF05198|IPR019814| GO:PFM GO:0003743|"GO:translation initiation factor activity"|PF00707|IPR019815| GO:PFM GO:0006413|"GO:translational initiation"|PF00707|IPR019815| RP:SCP:NREP 2 RP:SCP:REP 1->52|1tifA|3e-18|53.8|52/76|d.15.8.1| RP:SCP:REP 70->152|1tigA|2e-31|45.8|83/88|d.68.1.1| HM:SCP:REP 1->61|1tifA_|2.5e-21|65.6|61/76|d.15.8.1|1/1|Translation initiation factor IF3, N-terminal domain| HM:SCP:REP 65->154|2ifeA_|5.2e-33|57.8|90/0|d.68.1.1|1/1|Translation initiation factor IF3, C-terminal domain| OP:NHOMO 925 OP:NHOMOORG 902 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111112221111111111111111111111111111111111111111111-111111111111111112211111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111113111111111111111111111111111111111111111111-111111111111111111111111111-1111111111111111111111111111111-111111111111111111111111211111111111111111111111111111111111111111-111111111111111111111-1111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--111--1111111111111111111-11-11-111----1--11111-11111111111111111111111111111111-11111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111-11111-1111111111111111111111111111111111111111111-111111-11111--1-1111111111111111 ------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------2--1-11117111114--2-2111----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 84.9 SQ:SECSTR EEcTTccEEEEEEHHHHHHHHHHTTcEEEEEETTccccEEEEEcHH#######################EEEEETTccHHHHHHHHHHHHHHHHTTcEEEEEEEccTTccccHHHHHHHHHHHHTTcTTTcEEEEEEEGGGTEEEEEEEccc DISOP:02AL 50-68| PSIPRED cccccccEEccccHHHHHHHHHHccccEEEEcccccccEEEEEccHHHHHHHHHHHHHHHHccccEEEEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHEEcccccccccEEEEEEEEcc //