[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57650.1
DDBJ      :             Integration host factor, alpha subunit
Swiss-Prot:IHFA_NITOC   RecName: Full=Integration host factor subunit alpha;         Short=IHF-alpha;

Homologs  Archaea  1/68 : Bacteria  776/915 : Eukaryota  4/199 : Viruses  2/175   --->[See Alignment]
a.55.1
:99 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->92 1owfA PDBj 2e-39 79.1 %
:RPS:PDB   3->95 3c4iB PDBj 8e-24 37.6 %
:RPS:SCOP  3->70 1b8zA  a.55.1.1 * 1e-14 31.3 %
:HMM:SCOP  3->92 1exeA_ a.55.1.1 * 5.2e-29 46.7 %
:RPS:PFM   3->92 PF00216 * Bac_DNA_binding 1e-18 50.0 %
:HMM:PFM   3->91 PF00216 * Bac_DNA_binding 1.7e-32 48.3 89/90  
:BLT:SWISS 1->99 IHFA_NITOC 1e-53 100.0 %
:PROS 48->67|PS00045|HISTONE_LIKE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57650.1 GT:GENE ABA57650.1 GT:PRODUCT Integration host factor, alpha subunit GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1254925..1255224 GB:FROM 1254925 GB:TO 1255224 GB:DIRECTION + GB:PRODUCT Integration host factor, alpha subunit GB:PROTEIN_ID ABA57650.1 GB:DB_XREF GI:76882969 InterPro:IPR000119 InterPro:IPR005684 LENGTH 99 SQ:AASEQ MALTKADMTETLYQELGLNKREAKEIVEMFFEDIRCALEQGEAVKLSGFGNFELRDKGERPGRNPKTGEEIPITARRVVTFRPGQKLKARVEAYAGGKQ GT:EXON 1|1-99:0| SW:ID IHFA_NITOC SW:DE RecName: Full=Integration host factor subunit alpha; Short=IHF-alpha; SW:GN Name=ihfA; Synonyms=himA; OrderedLocusNames=Noc_1146; SW:KW Complete proteome; DNA recombination; DNA-binding; Transcription;Transcription regulation; Translation regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->99|IHFA_NITOC|1e-53|100.0|99/99| GO:SWS:NREP 5 GO:SWS GO:0006310|"GO:DNA recombination"|DNA recombination| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| GO:SWS GO:0006417|"GO:regulation of translation"|Translation regulation| PROS 48->67|PS00045|HISTONE_LIKE|PDOC00044| BL:PDB:NREP 1 BL:PDB:REP 2->92|1owfA|2e-39|79.1|91/96| RP:PDB:NREP 1 RP:PDB:REP 3->95|3c4iB|8e-24|37.6|93/97| RP:PFM:NREP 1 RP:PFM:REP 3->92|PF00216|1e-18|50.0|90/90|Bac_DNA_binding| HM:PFM:NREP 1 HM:PFM:REP 3->91|PF00216|1.7e-32|48.3|89/90|Bac_DNA_binding| GO:PFM:NREP 1 GO:PFM GO:0003677|"GO:DNA binding"|PF00216|IPR000119| RP:SCP:NREP 1 RP:SCP:REP 3->70|1b8zA|1e-14|31.3|67/67|a.55.1.1| HM:SCP:REP 3->92|1exeA_|5.2e-29|46.7|90/99|a.55.1.1|1/1|IHF-like DNA-binding proteins| OP:NHOMO 1816 OP:NHOMOORG 783 OP:PATTERN ------------------------------1------------------------------------- 232-----------11111-1111111111111111111111114--------1-11---12--1-----1-111111----1111232321-322---111221---1----------------2232222242211111---2-721-221112211111111111111111111111111---1111-211333333333344344221112334111111111111112-1111111111111111111111211211111111111211111111111111111111111111111-111111111111111111111211111111111111211111111-111111111111121111111211-121544333333422232222222233333333333-222233313331555511211222223422222422222444444443433353311111111----1----1111111111112335431211133353343333333432333334333432244412211224233325222213333433333232344443336354555254577554933234244-----------1-1-1-------1-544541434224443333444233242442441-3334331233334334344444444244-44444444444444444443334444444444444444444444444444441333333333333--6322222222232343333333333332333222222322254554542344444443331111111113644444444445443333333333333322F-------1--11111-11--11----1--------1-------1111111111--2 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----11---------------1------ ---------------------------1--------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 94 STR:RPRED 94.9 SQ:SECSTR #cccHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHTTccEEETTTEEEEEEEEccEEEEcTTTccEEEEccEEEEEEEEcHHHHHHHHTcc#### DISOP:02AL 94-99| PSIPRED ccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEEcccEEEEEEEEccccccccccccEEEEccccEEEEcccHHHHHHHHHcccccc //