[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57658.1
DDBJ      :             Lipolytic enzyme, G-D-S-L
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  195/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.10
:213 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   43->208 1jrlA PDBj 2e-14 30.3 %
:RPS:PDB   34->207 3bzwA PDBj 1e-21 17.2 %
:RPS:SCOP  43->208 1ivnA  c.23.10.5 * 9e-26 29.1 %
:HMM:SCOP  40->209 1jrlA_ c.23.10.5 * 1.5e-31 35.1 %
:RPS:PFM   43->201 PF00657 * Lipase_GDSL 8e-09 36.5 %
:HMM:PFM   43->138 PF00657 * Lipase_GDSL 1.7e-11 30.5 95/235  
:HMM:PFM   179->203 PF00657 * Lipase_GDSL 0.00089 36.0 25/235  
:BLT:SWISS 26->148 ESTE_VIBMI 5e-14 38.8 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57658.1 GT:GENE ABA57658.1 GT:PRODUCT Lipolytic enzyme, G-D-S-L GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1261791..1262432 GB:FROM 1261791 GB:TO 1262432 GB:DIRECTION + GB:PRODUCT Lipolytic enzyme, G-D-S-L GB:PROTEIN_ID ABA57658.1 GB:DB_XREF GI:76882977 InterPro:IPR001087 LENGTH 213 SQ:AASEQ MNAINCIWALTRYSLLGTILIVGVACSSGGSPELSKLPPNGIILAFGDSLTYGTGAGGSQYSYPSILAEKIDRQVINEGVPGELSGEGVARLSQMLDQYQPHLVILCHGGNDLLRQRTDSQIAVNLREMVELVQERGIEIVLLAVPRPALLFMEPAGFYAEIAGEYQIPIDSETLLNLEKNPAVKSDQIHLNREGYRLLAEAVFRLLRSSGAL GT:EXON 1|1-213:0| BL:SWS:NREP 1 BL:SWS:REP 26->148|ESTE_VIBMI|5e-14|38.8|116/200| TM:NTM 1 TM:REGION 11->33| BL:PDB:NREP 1 BL:PDB:REP 43->208|1jrlA|2e-14|30.3|165/178| RP:PDB:NREP 1 RP:PDB:REP 34->207|3bzwA|1e-21|17.2|174/240| RP:PFM:NREP 1 RP:PFM:REP 43->201|PF00657|8e-09|36.5|156/201|Lipase_GDSL| HM:PFM:NREP 2 HM:PFM:REP 43->138|PF00657|1.7e-11|30.5|95/235|Lipase_GDSL| HM:PFM:REP 179->203|PF00657|0.00089|36.0|25/235|Lipase_GDSL| GO:PFM:NREP 2 GO:PFM GO:0006629|"GO:lipid metabolic process"|PF00657|IPR001087| GO:PFM GO:0016788|"GO:hydrolase activity, acting on ester bonds"|PF00657|IPR001087| RP:SCP:NREP 1 RP:SCP:REP 43->208|1ivnA|9e-26|29.1|165/178|c.23.10.5| HM:SCP:REP 40->209|1jrlA_|1.5e-31|35.1|168/0|c.23.10.5|1/1|SGNH hydrolase| OP:NHOMO 205 OP:NHOMOORG 195 OP:PATTERN -------------------------------------------------------------------- --1----------------------------------------------------------------------------------------------------11----1--------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1---1---------1111------1--111--------------------------1----------------------------1-1----------------------------------------------1-11-----------------1111-----1--1--1--1-----------11--121121111111111---12-1---1-11--1--1-1111-1111-------1-----------------------------------11-1-----12----1122-22---1211------1111-111111111111-11111111-11111111111111----11111111111111111111---1-----------------2----------1111---------------11--1-1-1--1----111-111111111111-1111111-1-11111111111111111-----------111111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 190 STR:RPRED 89.2 SQ:SECSTR ##################HHHccccEEEEcccccccTTTTcEEEEEEcTTTcTTTTGGGcccHHHHHHHHHccEEEEcccTTccGGGHHHHHHHHHHHHTTccEEEEEcHHHHHTTcccccHHHHHHHHHHHHHHHcTTEEEEcccccccEEccTTcEHHHHHHHHTccEcHHHHTccTcGGGGGTEEEEEcHHHHHHHHHHHHGGGH##### DISOP:02AL 1-2| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEcccEEccccccccccHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEcccHHHHcccHHHHHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHcccEEEEHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHccc //