[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57667.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:141 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   29->133 PF01863 * DUF45 1e-12 36.6 %
:HMM:PFM   28->137 PF01863 * DUF45 4.5e-37 36.4 107/205  
:PROS 101->110|PS00142|ZINC_PROTEASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57667.1 GT:GENE ABA57667.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1273235..1273660 GB:FROM 1273235 GB:TO 1273660 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA57667.1 GB:DB_XREF GI:76882986 InterPro:IPR006025 LENGTH 141 SQ:AASEQ MSGSAPAGRVLLKNGYFYVNTTDFASGHIAKLMDEWYRERAAHYFAKVFAECWEKFKKNGFSKPVIKIMTMKKRWGSLSPNGTLTLNPALIKTPKACIEYVVMHELCHLQHHHHGPEFYQLLDRSLPDWMKRKHKLEMALA GT:EXON 1|1-141:0| PROS 101->110|PS00142|ZINC_PROTEASE|PDOC00129| SEG 104->114|helchlqhhhh| RP:PFM:NREP 1 RP:PFM:REP 29->133|PF01863|1e-12|36.6|101/198|DUF45| HM:PFM:NREP 1 HM:PFM:REP 28->137|PF01863|4.5e-37|36.4|107/205|DUF45| OP:NHOMO 59 OP:NHOMOORG 51 OP:PATTERN ---------------------------------------211-------------------------- -------------------------------------------------------------------------------1--------------------------------------------------1--------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------1-1---------------1----1----------1-------------------------------------------------------------1--------------------------1-21222222---1--------------------------------------1-------------------------------------------------------------------------1---------1-1-1------1-----------1----------------1-------------1-------------------1-----1--1----------------------------------------------------1----------------------------1-----1----------1-1-111-----1-------1------------1------------------------1-------------1-------1-11------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-10| PSIPRED cccccccccEEEEccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccEEEEEccccEEEEEHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHHHHHcc //