[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57681.1
DDBJ      :             protein translocase subunit yajC
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  385/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:111 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   26->103 PF02699 * YajC 2e-16 46.2 %
:HMM:PFM   24->103 PF02699 * YajC 9.6e-28 46.2 80/83  
:BLT:SWISS 26->111 YAJC_SHIFL 6e-17 40.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57681.1 GT:GENE ABA57681.1 GT:PRODUCT protein translocase subunit yajC GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1288167..1288502 GB:FROM 1288167 GB:TO 1288502 GB:DIRECTION + GB:PRODUCT protein translocase subunit yajC GB:PROTEIN_ID ABA57681.1 GB:DB_XREF GI:76883000 InterPro:IPR003849 LENGTH 111 SQ:AASEQ MNFFIADAWAQGGPPPGAPGDFWVPLLIFSTIFLVYYLLAIRPRLKRHKERLRMLASVNKGDEIITNGGLLGRILQVGDNFLLLELSEGMEVKVEKSAVSRVVPKGTAKSL GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 26->111|YAJC_SHIFL|6e-17|40.7|86/110| TM:NTM 1 TM:REGION 22->42| SEG 6->20|adawaqggpppgapg| RP:PFM:NREP 1 RP:PFM:REP 26->103|PF02699|2e-16|46.2|78/82|YajC| HM:PFM:NREP 1 HM:PFM:REP 24->103|PF02699|9.6e-28|46.2|80/83|YajC| OP:NHOMO 388 OP:NHOMOORG 385 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------111-------1------------1-1-----1-1------1--------1----------------1--1---11-----------------------------------------------------------------------------------------1------11------------------------------------------------------------------------------------------1-----------------------------------1---------1-------111-----11111-1111111------------11-11-11--1----1---------11-11-1----111------------------1--111----11---1-11-11--1---11--1111111111111111111111111111111111111111111111111111111-11111-1---111111111--111111111-11111-111----1-111111-111111--------------111111111111111111111111111111111-122211--11111111111111111111-111111111111111111111111111111111111111111111111111-11111111111111111111111111-1111111111111111--1111111111111111111111111111111111111111111111111111111111111111----11-------------------------------------------------------11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 43-58, 110-111| PSIPRED cccccccHHHcccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccEEEEEccEEEEEEEEcccEEEEEEcccEEEEEEEHHHHHHccccccccc //