[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57685.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:161 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57685.1 GT:GENE ABA57685.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1290811..1291296) GB:FROM 1290811 GB:TO 1291296 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57685.1 GB:DB_XREF GI:76883004 LENGTH 161 SQ:AASEQ METKQGYETKELRDGIGLKKTKRKMAEVFEAHCVDSWVLANGWTGGHTYPDNKQLLCITPLRFHRRQLHRLQFSKGGIRKPYGGTLSHGFKRGSLVKHPKWGLAYVGGCLKDRISLHAVASGRRLCQNAKPADCRFLTFNTWRTRALPLTPKVGSPAPKNL GT:EXON 1|1-161:0| SEG 61->73|lrfhrrqlhrlqf| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 16-31, 155-161| PSIPRED cccccccccHHHHHHccccccHHHHHHcHHHccEEEEEEEccccccEEEcccEEEEEEccccccHHEEEEEEcccccccccccccEEcccccccEEEcccccEEEEEEccccEEEEEEccccHHHccccccccEEEEEEccccEEEEEccccccccccccc //