[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57689.1
DDBJ      :             regulatory inactivation of DnaA Hda protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  654/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:232 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->229 3bosB PDBj 1e-33 38.1 %
:RPS:PDB   1->210 3bq9A PDBj 5e-11 9.7 %
:RPS:SCOP  17->196 1l8qA2  c.37.1.20 * 1e-19 25.1 %
:HMM:SCOP  10->213 1l8qA2 c.37.1.20 * 5.3e-22 25.9 %
:RPS:PFM   17->217 PF00308 * Bac_DnaA 5e-23 33.8 %
:HMM:PFM   17->211 PF00308 * Bac_DnaA 3.7e-24 29.2 195/219  
:BLT:SWISS 5->232 HDA_YERE8 4e-47 43.2 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57689.1 GT:GENE ABA57689.1 GT:PRODUCT regulatory inactivation of DnaA Hda protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1294620..1295318 GB:FROM 1294620 GB:TO 1295318 GB:DIRECTION + GB:PRODUCT regulatory inactivation of DnaA Hda protein GB:PROTEIN_ID ABA57689.1 GB:DB_XREF GI:76883008 LENGTH 232 SQ:AASEQ MVTQQLPLPIGDSGAPSFENYYLAAANRESVAAVERCGQGKGDRFLCLRGPSGVGKTHLLLAACQIAAQKGERVAYVPLKRAVIMAPEILGGLEVAAFVAIDDIDHIAGYRHWEESLLHLYNLLQEGRGRLLLASTDKPSTLHWLLPDLRSRLGWGLGYQLQPLDDHQKHAALQFQAAKRGLELPDEVAGFLLRHSERDMHSLSSILAQLERASMAAQRRLTVPFVRQVLDI GT:EXON 1|1-232:0| BL:SWS:NREP 1 BL:SWS:REP 5->232|HDA_YERE8|4e-47|43.2|227/239| COIL:NAA 29 COIL:NSEG 1 COIL:REGION 193->221| BL:PDB:NREP 1 BL:PDB:REP 5->229|3bosB|1e-33|38.1|218/223| RP:PDB:NREP 1 RP:PDB:REP 1->210|3bq9A|5e-11|9.7|207/446| RP:PFM:NREP 1 RP:PFM:REP 17->217|PF00308|5e-23|33.8|201/218|Bac_DnaA| HM:PFM:NREP 1 HM:PFM:REP 17->211|PF00308|3.7e-24|29.2|195/219|Bac_DnaA| RP:SCP:NREP 1 RP:SCP:REP 17->196|1l8qA2|1e-19|25.1|179/213|c.37.1.20| HM:SCP:REP 10->213|1l8qA2|5.3e-22|25.9|197/213|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 881 OP:NHOMOORG 658 OP:PATTERN -------------------------------------------------------------------- 111111------1111112111111111111111111111-11111-1111-111111--1111-111111-----------1-----111111--1----1111111221111111111----111111111111111--111-1111111-1111111-111111---11111111111111111111-111111111111111111111111111111-11111111111111111111111111-111----1--1----11---------------------------------------------------------11111111111111111111111111--1--1-111111111111111--11-1111--------11-1------------------11-1111---2-------------1----2-2111111111111111-111112222211111112222221212212222122-11-1-222211111111111111111111111111222111111111111111111111112211111111111111-----1--------1212222121111111-1-1--------1111111111111122222222222222222222222222222222--122221--11122222222221222222-2212222222222222222222222222222222222222222222212122-222222222222--22222222222322212221222222222221111111112222222222222222222211111111121111111111111122222222222222222---------------------------------------------1-------11- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------2-----------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 231 STR:RPRED 99.6 SQ:SECSTR cHHHHHHHHHHHccEEEEccccHHHHHHHHHHHHHHTcGGGTTccccEEEEEcGGGHHHHHHHHTcTTGGGGcEEEEccHHHHHHHHHHHHHHHHHHHHHTTccccccccccccGGGTccccccHHHHHTccccTTccHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHccEEEEcHHHHHHHHHHHHHHTTccccTTccccccEEEHHHHHHHTccccHHHHHHHHH# DISOP:02AL 1-2| PSIPRED ccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcc //