[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57698.1
DDBJ      :             Protein of unknown function UPF0125
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  253/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.15.3
:99 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->83 2hj1B PDBj 1e-17 48.8 %
:RPS:PDB   6->80 3biiD PDBj 8e-08 18.7 %
:RPS:SCOP  6->81 2hj1A1  d.15.3.4 * 2e-15 48.7 %
:RPS:PFM   9->90 PF03658 * UPF0125 1e-22 68.3 %
:HMM:PFM   7->89 PF03658 * UPF0125 1.5e-35 62.7 83/84  
:BLT:SWISS 7->91 RNFH_METCA 5e-24 58.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57698.1 GT:GENE ABA57698.1 GT:PRODUCT Protein of unknown function UPF0125 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1303954..1304253) GB:FROM 1303954 GB:TO 1304253 GB:DIRECTION - GB:PRODUCT Protein of unknown function UPF0125 GB:PROTEIN_ID ABA57698.1 GB:DB_XREF GI:76883017 InterPro:IPR005346 LENGTH 99 SQ:AASEQ MASVKMMTVEVAYARPDKQVILKASVPENTTLEAAIQASGILEQFPEIDLDKNKVGIFGKLSKRDAPLCFGNRIEIYRPLIADPKQARRERATKARQAK GT:EXON 1|1-99:0| BL:SWS:NREP 1 BL:SWS:REP 7->91|RNFH_METCA|5e-24|58.8|85/95| BL:PDB:NREP 1 BL:PDB:REP 4->83|2hj1B|1e-17|48.8|80/80| RP:PDB:NREP 1 RP:PDB:REP 6->80|3biiD|8e-08|18.7|75/80| RP:PFM:NREP 1 RP:PFM:REP 9->90|PF03658|1e-22|68.3|82/84|UPF0125| HM:PFM:NREP 1 HM:PFM:REP 7->89|PF03658|1.5e-35|62.7|83/84|UPF0125| RP:SCP:NREP 1 RP:SCP:REP 6->81|2hj1A1|2e-15|48.7|76/77|d.15.3.4| OP:NHOMO 261 OP:NHOMOORG 254 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111----------------1------------------------------------11---11111111111111111111111111111---1-11------1--1121111111111111111222-----------------------------------------------------------1121111111111111111111111111111-111211-----11111111111111-11-1111111111111111111111111111111111111111111111111111-111111111111---111111----11111111111111111111111111----11111111111----2111111111111111111111111111--------------111-------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 80.8 SQ:SECSTR ###cccEEEEEcHHHHHHHcccEEEEcccccHHHHHHHHHTTHHHHHHccTTcEEEETTEEccTTccccTTcEEEEEcccccc################ DISOP:02AL 1-4, 89-99| PSIPRED ccccccEEEEEEEEccccEEEEEEEEccccHHHHHHHHccHHHHccccccccccEEEEEEEcccccHHccccEEEEEccccccHHHHHHHHHHHHHHcc //