[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57703.1
DDBJ      :             Protein of unknown function DUF86
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.24.16
:115 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  12->106 1wtyA  a.24.16.2 * 1e-06 17.6 %
:RPS:PFM   12->104 PF01934 * DUF86 1e-08 40.2 %
:HMM:PFM   13->105 PF01934 * DUF86 6.6e-24 41.3 92/119  
:BLT:SWISS 3->113 Y101_METAC 2e-12 31.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57703.1 GT:GENE ABA57703.1 GT:PRODUCT Protein of unknown function DUF86 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1310063..1310410) GB:FROM 1310063 GB:TO 1310410 GB:DIRECTION - GB:PRODUCT Protein of unknown function DUF86 GB:PROTEIN_ID ABA57703.1 GB:DB_XREF GI:76883022 InterPro:IPR008201 LENGTH 115 SQ:AASEQ MTQSWQPYAKHILDAIAKVRRIEARGDLTQDEVLYDAVLRNLQTLSEATQLLPEEKKASCPEIPWREISGFRNILVHNYLGEIDPLTVKTVITQHLPPLEACVRTLLINAGETEL GT:EXON 1|1-115:0| BL:SWS:NREP 1 BL:SWS:REP 3->113|Y101_METAC|2e-12|31.8|110/119| RP:PFM:NREP 1 RP:PFM:REP 12->104|PF01934|1e-08|40.2|92/118|DUF86| HM:PFM:NREP 1 HM:PFM:REP 13->105|PF01934|6.6e-24|41.3|92/119|DUF86| RP:SCP:NREP 1 RP:SCP:REP 12->106|1wtyA|1e-06|17.6|91/116|a.24.16.2| OP:NHOMO 57 OP:NHOMOORG 41 OP:PATTERN ---------------------------------------------12---2------1---------- ---1------------------------------------------------------------------------------------------------------------------------------------1--24------132222--11-------21-----------------1-121---------------------------------------------------------------------------------------------------------------------------------------1--------------------------------11---2-11---11---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1--------------------11------------------------------------------------------------------------1-12---------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------1---1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 112-115| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //