[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57713.1
DDBJ      :             guanylate kinase
Swiss-Prot:KGUA_NITOC   RecName: Full=Guanylate kinase;         EC=2.7.4.8;AltName: Full=GMP kinase;

Homologs  Archaea  0/68 : Bacteria  889/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:203 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->180 2ancD PDBj 6e-56 56.2 %
:RPS:PDB   14->128 2ao9E PDBj 5e-20 8.9 %
:RPS:SCOP  12->180 1jxmA2  c.37.1.1 * 6e-35 31.3 %
:HMM:SCOP  2->185 1kjwA2 c.37.1.1 * 1.2e-67 47.8 %
:RPS:PFM   5->180 PF00625 * Guanylate_kin 6e-47 50.0 %
:HMM:PFM   5->182 PF00625 * Guanylate_kin 6e-52 39.9 178/183  
:BLT:SWISS 1->203 KGUA_NITOC e-103 100.0 %
:PROS 37->54|PS00856|GUANYLATE_KINASE_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57713.1 GT:GENE ABA57713.1 GT:PRODUCT guanylate kinase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1325912..1326523 GB:FROM 1325912 GB:TO 1326523 GB:DIRECTION + GB:PRODUCT guanylate kinase GB:PROTEIN_ID ABA57713.1 GB:DB_XREF GI:76883032 InterPro:IPR008144 InterPro:IPR008145 LENGTH 203 SQ:AASEQ MSGSLFIVAAPSGAGKTSLVKALAASMADIRLSISHTTRPPRPGEQDGMDYHFVTEAIFETMEGGGGFLEHAQVFGHRYGTAKESVLPLLAQGMDVILEIDWQGRRQVQAQFPHCVSIFILPPSRETLEHRLRLRGQDTEAVVARRMGDACAEISHYNEFDYLVVNDDFEVAHTDLRAIVQSRRLLRLRQEKRLKSLLGELLE GT:EXON 1|1-203:0| SW:ID KGUA_NITOC SW:DE RecName: Full=Guanylate kinase; EC=2.7.4.8;AltName: Full=GMP kinase; SW:GN Name=gmk; OrderedLocusNames=Noc_1212; SW:KW ATP-binding; Complete proteome; Cytoplasm; Kinase; Nucleotide-binding;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->203|KGUA_NITOC|e-103|100.0|203/203| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 37->54|PS00856|GUANYLATE_KINASE_1|PDOC00670| SEG 181->198|qsrrllrlrqekrlksll| BL:PDB:NREP 1 BL:PDB:REP 3->180|2ancD|6e-56|56.2|178/204| RP:PDB:NREP 1 RP:PDB:REP 14->128|2ao9E|5e-20|8.9|112/115| RP:PFM:NREP 1 RP:PFM:REP 5->180|PF00625|6e-47|50.0|176/183|Guanylate_kin| HM:PFM:NREP 1 HM:PFM:REP 5->182|PF00625|6e-52|39.9|178/183|Guanylate_kin| RP:SCP:NREP 1 RP:SCP:REP 12->180|1jxmA2|6e-35|31.3|166/199|c.37.1.1| HM:SCP:REP 2->185|1kjwA2|1.2e-67|47.8|182/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1915 OP:NHOMOORG 1080 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111111111111111111--111111111111111111111-111111111111---111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111122-222221222222222122211111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111-11111111111311111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-----------111111-11111111111111111111111111111-11 11-1113-5211222-1111111-11-11111121311-1-11111112243222322322211111111111111111111111111-1111111111111111112717SNGNJCA6467B5UN1T2**E1RDW7454I59F948655E34J8979C48534441A33524343454Q1111252241322311111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 180 STR:RPRED 88.7 SQ:SECSTR cEEEEEEEEGGGTHHHHHHHTTccHHHHHHHHHHHHHHccccccHHHHHHHHTccHHHHHHHHHcHHHHHHHHHHHHHHHHTcTTHHHHHHHHHHHHHcTccccHHHHHHHHHHTTcccccccccccccccccccGGGcHHHHHHHHHHHHHHHHHHHHcEEEEEcccHHHHHHHHHHHH####################### DISOP:02AL 40-45, 131-143| PSIPRED cccEEEEEEccccccHHHHHHHHHHHcccccEEEEEEccccccccccccccccccHHHHHHHHHcccEEEEEEEccccccccHHHHHHHHHcccEEEEEccHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //