[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57721.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:244 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   101->128 PF00908 * dTDP_sugar_isom 0.00015 38.5 26/177  
:BLT:SWISS 6->115 Y035_CHLTR 1e-04 32.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57721.1 GT:GENE ABA57721.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1335485..1336219 GB:FROM 1335485 GB:TO 1336219 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA57721.1 GB:DB_XREF GI:76883040 LENGTH 244 SQ:AASEQ MTQKTPLFSLLFALWGASSLVLAHTVITDQATEGTSLYTGFNITHGCGFEDKPSLPVIAQSVVFPNGPNAIVTRLDTEEAIDLGDVLVGGAHAATLINPAIIQNRDVFDINESISDETGVVRGVHYTEGGLPPELDAVLPFRVSGVTFVEESCATKVRARIGIANWCHHRPGARRADVWIGRLTPVFNDERVVSIGFWPVLTFNRDLASNPLPADCGEGYEVAVEPSDESIDQYLPVPDFIPGV GT:EXON 1|1-244:0| BL:SWS:NREP 1 BL:SWS:REP 6->115|Y035_CHLTR|1e-04|32.0|100/100| HM:PFM:NREP 1 HM:PFM:REP 101->128|PF00908|0.00015|38.5|26/177|dTDP_sugar_isom| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccHHHHHHHHHHccccEEEEEEEEEccccccEEEEEcEEEcccccccccccccEEEEEEEccccccEEEEEccccccccHHHEEEccccHHHHccHHHHcccHHHHHcccccccccEEEEEEEEccccccccEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEEcccccEEEEEEEcccccEEccccEEEcccccEEEEEcccccccccHHHcccEEEEEcccHHHHHcccccccccccc //