[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57730.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:209 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   8->202 3bfxB PDBj 5e-06 13.3 %
:RPS:SCOP  72->202 1fmjA  c.37.1.5 * 2e-05 11.5 %
:HMM:SCOP  5->202 1hy3A_ c.37.1.5 * 4.3e-07 19.3 %
:HMM:PFM   2->94 PF03567 * Sulfotransfer_2 3.8e-06 22.2 90/253  
:BLT:SWISS 1->92 CHSTA_HUMAN 3e-04 25.3 %
:BLT:SWISS 63->169 Y604_ARCFU 7e-16 40.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57730.1 GT:GENE ABA57730.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1346034..1346663 GB:FROM 1346034 GB:TO 1346663 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57730.1 GB:DB_XREF GI:76883049 LENGTH 209 SQ:AASEQ MIISHKYQFIFIKNGKTAGTSIEVFLSKFCGSFDIVTPIYPAVESHFPRNYAGFYNRMTSAEIREKIGKKTWKNYFKFCVERNPWDKAISYYYMAKCRTGGNLSLDKFLDGCEFPINFPRYTEPGNSSKIIVDKIIDFNNLIEGLGEVFGRLGLPFDGSLGVYAKSEYRTDRRPYQEVLTASQARKIQEIFAVEIDLHGYHFQKVKLIA GT:EXON 1|1-209:0| BL:SWS:NREP 2 BL:SWS:REP 1->92|CHSTA_HUMAN|3e-04|25.3|87/356| BL:SWS:REP 63->169|Y604_ARCFU|7e-16|40.2|107/120| RP:PDB:NREP 1 RP:PDB:REP 8->202|3bfxB|5e-06|13.3|195/248| HM:PFM:NREP 1 HM:PFM:REP 2->94|PF03567|3.8e-06|22.2|90/253|Sulfotransfer_2| RP:SCP:NREP 1 RP:SCP:REP 72->202|1fmjA|2e-05|11.5|131/342|c.37.1.5| HM:SCP:REP 5->202|1hy3A_|4.3e-07|19.3|187/0|c.37.1.5|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 8 OP:NHOMOORG 7 OP:PATTERN -----------------------1-------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------2-----------1----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 195 STR:RPRED 93.3 SQ:SECSTR #######cEEEEEcTTccHHHHHHHHHHHHHTccccTTcccTccHHHHHHHcccccEEEEcccTTTccGGGGGTTcEEEEEccHHHHHHHHHHHHHHcTTccHHHHHHHTTccTTccHHHHHHHTTTcEEEEEEHHHHHcHHHHHHHHHHHTTcccHHHHHHHHHTcccccccGGGGTccHHHHHHHHHHHHHHTTTccccc####### PSIPRED ccccccccEEEEEcccccHHHHHHHHHHHcccccccccccHHHccccHHHHHHHHHcccHHHHHHHccHHHHHHHEEEEEEccHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccEEEEcccccccccEEEEEccHHHHHHHHHHHccccHHcccccccccccccccHHHHHHccHHHHHHHHHHHHHHHHHccccHHHccccc //