[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57769.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.103.1
:266 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  30->244 1aj8A_ a.103.1.1 * 1.4e-09 22.8 %
:HMM:PFM   30->242 PF00285 * Citrate_synt 2.1e-10 21.8 206/356  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57769.1 GT:GENE ABA57769.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1399173..1399973 GB:FROM 1399173 GB:TO 1399973 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57769.1 GB:DB_XREF GI:76883088 LENGTH 266 SQ:AASEQ MQGPKYLFENEDHWRTAMGAWFPGERVVFRGKDLFKELKDLPWMGLLLYGITGRIPNGKQIRLFDGIWTLCTSYPDPRLWNNRVAALAGTTRSTAALALSAGNAVSEASIYGRRPDIRAIDFLLRVKCQLEAGAEIEEIVIKELKKYKIIPGYGRPITRKDERIEPLLSLAEEIDFSHGPYVKLAFMIEETLLQGRRRLHMNIAALAAALAADQGLSCREYYHYSILSFSAGMLPCYVEAVRKPEGVFFPLSCDRIQYKGKPRRVW GT:EXON 1|1-266:0| SEG 85->102|aalagttrstaalalsag| SEG 135->150|eieeivikelkkykii| SEG 204->212|aalaaalaa| HM:PFM:NREP 1 HM:PFM:REP 30->242|PF00285|2.1e-10|21.8|206/356|Citrate_synt| HM:SCP:REP 30->244|1aj8A_|1.4e-09|22.8|206/371|a.103.1.1|1/1|Citrate synthase| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------1----------------------------1------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 263-266| PSIPRED ccccccccccHHHHHHHHccccccccEEEccccHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccc //