[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57778.1
DDBJ      :             conserved hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:176 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   51->173 PF07291 * MauE 1.7e-07 18.7 123/184  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57778.1 GT:GENE ABA57778.1 GT:PRODUCT conserved hypothetical membrane protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1419126..1419656 GB:FROM 1419126 GB:TO 1419656 GB:DIRECTION + GB:PRODUCT conserved hypothetical membrane protein GB:PROTEIN_ID ABA57778.1 GB:DB_XREF GI:76883097 LENGTH 176 SQ:AASEQ MGGSLSSNDAKVRDQERGEMLADYWPLISLVGGSALAAWAIADGFASVDMRTFMHAYMGVFLLVFALLKIFNLNGFQDGFVMYDLLAKRVRAYGYVYPFIELALAIMYLNFMAPEFTYWATVGVFSFGAIGVVIALRQGLDINCPCMGSVLSVPLSTVTLTEDIGMLVMALLLLFV GT:EXON 1|1-176:0| TM:NTM 5 TM:REGION 23->45| TM:REGION 53->75| TM:REGION 92->114| TM:REGION 117->139| TM:REGION 149->171| HM:PFM:NREP 1 HM:PFM:REP 51->173|PF07291|1.7e-07|18.7|123/184|MauE| OP:NHOMO 43 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------1-------1-----------------------------------------1--111---------1---------1----11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22----------1-1--1---1-2-------------------------------------------------------21-2--------------------------------------------------------------------------------------------------------------------------------------2---1-------------------------1-----------------------------------------------------------------------------------------------------1111--1----------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-19| PSIPRED cccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEccHHHHHHHHHHHHHcccccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHc //