[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57783.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:236 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   106->219 PF04039 * MnhB 2.6e-07 26.2 107/124  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57783.1 GT:GENE ABA57783.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1424702..1425412) GB:FROM 1424702 GB:TO 1425412 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA57783.1 GB:DB_XREF GI:76883102 LENGTH 236 SQ:AASEQ MTPNKSRLATTTMIDPYRIVLLSLLLVLMAILIRGVMDLAPIATGLGPMVFAAKEPGGEISPVTAVLLLFRDYDTLLELAVLLLALIGVWSFGEAPPPPSPSPPGPILLDFLRLVLPLMALAFFYLVWAGGSAAGGAFQGGAMLGTIGALFRLSNLSEIPLPPEIWLRLAAALGIAIFLTVAMIPLVGGDLLLAVSPQWMKTKILWLEFPAALSIGVILAALFAGGQPRRHTNNQP GT:EXON 1|1-236:0| TM:NTM 5 TM:REGION 20->42| TM:REGION 66->88| TM:REGION 107->129| TM:REGION 171->193| TM:REGION 203->224| SEG 19->33|ivllslllvlmaili| SEG 76->86|llelavlllal| SEG 96->106|ppppspsppgp| SEG 129->145|aggsaaggafqggamlg| HM:PFM:NREP 1 HM:PFM:REP 106->219|PF04039|2.6e-07|26.2|107/124|MnhB| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 92-107, 226-236| PSIPRED cccccHHEEHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //