[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57803.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.375.1
:90 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->85 2hfqA PDBj 6e-21 50.0 %
:RPS:SCOP  1->85 2hfqA1  d.375.1.1 * 1e-22 50.0 %
:RPS:PFM   1->82 PF09630 * DUF2024 1e-19 55.6 %
:HMM:PFM   1->82 PF09630 * DUF2024 6.8e-38 48.1 81/81  
:BLT:SWISS 3->75 SYM_HALMA 7e-04 24.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57803.1 GT:GENE ABA57803.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1448537..1448809) GB:FROM 1448537 GB:TO 1448809 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA57803.1 GB:DB_XREF GI:76883122 LENGTH 90 SQ:AASEQ MQIDVFDTYVTTTEGKRLHFDVFLPTGKQGELARQYAKEWLESIGIHAKDVQQESCAYCHSEAANPKVQQHIKQHGYYIYQMEGCPSPER GT:EXON 1|1-90:0| BL:SWS:NREP 1 BL:SWS:REP 3->75|SYM_HALMA|7e-04|24.7|73/100| BL:PDB:NREP 1 BL:PDB:REP 1->85|2hfqA|6e-21|50.0|84/85| RP:PFM:NREP 1 RP:PFM:REP 1->82|PF09630|1e-19|55.6|81/81|DUF2024| HM:PFM:NREP 1 HM:PFM:REP 1->82|PF09630|6.8e-38|48.1|81/81|DUF2024| RP:SCP:NREP 1 RP:SCP:REP 1->85|2hfqA1|1e-22|50.0|84/85|d.375.1.1| OP:NHOMO 16 OP:NHOMOORG 14 OP:PATTERN ------------------------------------------------------------------12 -----------------------------------------------------------------------------------------------------1---2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------------------------------------------------------------------1----------------------1---1-----------------------------------------------------------------------------------------------------------------------------------------1111-------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 93.3 SQ:SECSTR cEEEEEEEEEcccccccEEEEEEEcc#ccHHHHHHHHHHHHHHHTcccccccTTTccccEEEEccHHHHHHHHHHcEEEEccccc##### DISOP:02AL 87-90| PSIPRED cEEEEEEEEEEEcccEEEEEEEEEcccccHHHHHHHHHHHHHHccccccccccccHHHHccccccHHHHHHHHHccEEEEEEcccccccc //