[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57825.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:244 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  25->209 1k4jA  d.108.1.3 * 2e-11 18.5 %
:HMM:SCOP  15->241 1ro5A_ d.108.1.3 * 3.8e-27 28.4 %
:RPS:PFM   24->203 PF00765 * Autoind_synth 8e-13 40.0 %
:HMM:PFM   24->134 PF00765 * Autoind_synth 9.9e-07 28.4 102/182  
:BLT:SWISS 8->196 VANI_VIBAN 3e-05 28.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57825.1 GT:GENE ABA57825.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1475891..1476625) GB:FROM 1475891 GB:TO 1476625 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA57825.1 GB:DB_XREF GI:76883144 LENGTH 244 SQ:AASEQ MTESLAEIYKKYFEIYPQVDEAPEQLAEVYRLRFQVYCVENPFEDSSHHPDGLEKDPFDDCSIHSLLVHRQTSLTAGTVRLVLPSEDNPALALPINQLCREPLLNDLNLLPRSTLAEVSRFAVSKNFRRRLGEASSPSGVSTEWHEAQAREQGRKIPHLCLGLIQALVGNSYKYGVTHWSAVMEPALLRMLKRVGIHFINSGPLIEYHGWRQPCYAELAPMLSQVKLERPDVWELITDDGRYGQ GT:EXON 1|1-244:0| BL:SWS:NREP 1 BL:SWS:REP 8->196|VANI_VIBAN|3e-05|28.8|153/193| RP:PFM:NREP 1 RP:PFM:REP 24->203|PF00765|8e-13|40.0|150/172|Autoind_synth| HM:PFM:NREP 1 HM:PFM:REP 24->134|PF00765|9.9e-07|28.4|102/182|Autoind_synth| GO:PFM:NREP 1 GO:PFM GO:0007165|"GO:signal transduction"|PF00765|IPR001690| RP:SCP:NREP 1 RP:SCP:REP 25->209|1k4jA|2e-11|18.5|151/193|d.108.1.3| HM:SCP:REP 15->241|1ro5A_|3.8e-27|28.4|190/0|d.108.1.3|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 28 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----1-------------22211---2----------------2------------------------------------------2--3-1------------------------511--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 241-244| PSIPRED ccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEcccccEEEEEEEEcccccccccccccHHHccccccccccccccccEEEEHHHEEcHHHHcccccccccccccccccccHHHHHccccccHHHHHHHHHHHHHHHcccEEEEEEEcHHHHHHHHHccEEEEEccccEEEcccccEEEEEHHHHHHccccccccHHHHHHHcccccc //